DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fnta and Fnta

DIOPT Version :9

Sequence 1:NP_001260048.1 Gene:Fnta / 33682 FlyBaseID:FBgn0031633 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_032059.1 Gene:Fnta / 14272 MGIID:104683 Length:377 Species:Mus musculus


Alignment Length:324 Identity:157/324 - (48%)
Similarity:230/324 - (70%) Gaps:14/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEYLGTD---WLAYSERSDWEDVQPLAQDDGPNPVVSIAYSQKFREVFDYMRAIIARGEKSQRA 67
            |:.:|..|   ::.|.:|::|.|:.|:.|:|||||||.|.||:|||:|:||.||::.|.|:|:||
Mouse    52 DDGFLSLDSPTYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSEKFRDVYDYFRAVLQRDERSERA 116

  Fly    68 LDLTTDALRLNPANYTVWQYRRDVLRELKADLYAELDYLTEVIGQNSKNYQVWHHRRVIVEMLND 132
            ..||.||:.||.||||||.:||.:||.|:.||..|::|:|.:|.:..|||||||||||:||.|.|
Mouse   117 FKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKD 181

  Fly   133 PSNELELTENALVNDGDAKNYHAWQHRQWAIRSFNLYDDELSFVDRLISEDQRNNSAWNQRFFVI 197
            ||.|||...:.|  ..|||||||||||||.|:.|.|:|:||.:||:|:.||.||||.||||.|||
Mouse   182 PSQELEFIADIL--SQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVI 244

  Fly   198 KH-FGFTPE-LIQRELSYTMNRIRIIKNNESAWNYLVGVMRQGDSGNALLSSYPDVVDFVEELYQ 260
            .: .|::.. :::||:.||:..|:::.:||||||||.|:::  |.|   ||.||::::.:.:| |
Mouse   245 SNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQ--DRG---LSRYPNLLNQLLDL-Q 303

  Fly   261 AGNRSPYLLAFLIDLYQEQALQLKASDSDQLARKVYGLCEDMATKHDVIRRKYWQYVANHLKNQ 324
            ..:.||||:|||:|:| |..|:.:..:.:.:..|...|||.:|.:.|.||::||:|:...|:::
Mouse   304 PSHSSPYLIAFLVDVY-EDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FntaNP_001260048.1 PLN02789 14..314 CDD:215423 150/301 (50%)
FntaNP_032059.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 1/2 (50%)
PPTA 64..365 CDD:332411 152/302 (50%)
PFTA 1 112..146 20/33 (61%)
PFTA 2 147..181 20/33 (61%)
PFTA 3 182..214 19/31 (61%)
PFTA 4 215..249 20/34 (59%)
PFTA 5 255..289 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835956
Domainoid 1 1.000 77 1.000 Domainoid score I8861
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1534
Inparanoid 1 1.050 325 1.000 Inparanoid score I2469
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54481
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005243
OrthoInspector 1 1.000 - - oto94353
orthoMCL 1 0.900 - - OOG6_102620
Panther 1 1.100 - - LDO PTHR11129
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R453
SonicParanoid 1 1.000 - - X3760
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.