DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and GLYATL1

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_542392.2 Gene:GLYATL1 / 92292 HGNCID:30519 Length:333 Species:Homo sapiens


Alignment Length:191 Identity:36/191 - (18%)
Similarity:62/191 - (32%) Gaps:71/191 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 EDAEMRLLNLDNVQGIHDLY---PANEIECVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGA 218
            |.:|:.||.....:..|..|   |...|:..:...|:...|.||.::..        :.|..:|.
Human    13 EGSEVELLVSPGARSEHGRYLQDPIVSIDLSEWLRIIEFLLQGLKVYGS--------VYHINHGN 69

  Fly   219 MFSMQ----TRPDFRRMGYGIRLAKSLTQLVIERGYTPFVVIRPGNDASRSLYTKLGYEKAFETC 279
            .|:|:    :.|:::                       .|:|||.                    
Human    70 PFNMEVLVDSWPEYQ-----------------------MVIIRPQ-------------------- 91

  Fly   280 RVRMTPDCYEDSTVGTISNTSYGKFPPLPQ------GDCVVVTKLRRKHVPGESQTVDEGI 334
            :..||.|....:.|       |..|...||      .:|.:|...:|..:.|..:::.|||
Human    92 KQEMTDDMDSYTNV-------YRMFSKEPQKSEEVLKNCEIVNWKQRLQIQGLQESLGEGI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 11/88 (13%)
GLYATL1NP_542392.2 Gly_acyl_tr_N 51..238 CDD:283638 27/153 (18%)
Gly_acyl_tr_C 239..327 CDD:117021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.