DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and Glyatl3

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001138534.1 Gene:Glyatl3 / 688536 RGDID:1587643 Length:290 Species:Rattus norvegicus


Alignment Length:315 Identity:66/315 - (20%)
Similarity:108/315 - (34%) Gaps:98/315 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LERYLPESLKFHQTIKTYLNDRIWDFKFYVAKDWPD-KPIIL------------HFPGCTLAPHN 76
            |:.:.|||||.:..:........:. |..|...||| |.||.            |:.......:.
  Rat    17 LKSHFPESLKVYGAVMNINRGNPFQ-KEVVLDSWPDFKAIITRRQREAVTDNLDHYTNAYAVFYK 80

  Fly    77 NI--YQTLGIFCPSAHIEHVDMLRTEDVLIDWQKPMYLNFTHIAIMNRLDDFYSKFGVMERLSGD 139
            ::  ||.|              |...|| |:|                 |..:.    ::.|..:
  Rat    81 DVRAYQQL--------------LEEHDV-INW-----------------DQIFQ----IQGLQSE 109

  Fly   140 IYVCNKLNA-----DLELE----------PLPED------------------AEMRLLNLDNVQG 171
            :|..:|..|     |||::          |:..:                  .:..|||....:|
  Rat   110 LYTASKAIASAKLLDLEIKLASFKAVHFSPVSSEPDHSFLTGSTPRLTYLSVTDADLLNRTWSRG 174

  Fly   172 IHDLYPANEIECVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRRMGYGIR 236
                  .|: :|::....|:...|.:.: |.|.|...:|.:...:..|....|.||.||.||...
  Rat   175 ------GNQ-QCLRYLAKLIACFPSVCV-RDEKGNPVSWGITDQFATMCHGYTLPDHRRKGYSRL 231

  Fly   237 LAKSLTQLVIERGYTPFVVIRPGNDASRSLYTKLGYEKAFETCRVR---MTPDCY 288
            :|.:|.:.:..||:.....:...|.||.:|...:..|  |..||..   :||..:
  Rat   232 VALTLARKLQSRGFPSQGNVLDDNMASINLLKSVHAE--FLPCRFHRLILTPAAF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 23/84 (27%)
Glyatl3NP_001138534.1 Gly_acyl_tr_N 1..192 CDD:399190 39/218 (18%)
NAT_SF 193..281 CDD:418431 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.