DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and Keg1

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_083826.1 Gene:Keg1 / 64697 MGIID:1928492 Length:295 Species:Mus musculus


Alignment Length:291 Identity:60/291 - (20%)
Similarity:102/291 - (35%) Gaps:70/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TLERYLPESLKFHQTIKTYLNDRIWDFKFYVAKDWPDKPIILHFPGCTLAP-----------HNN 77
            :|.::||||||.:.|:........:..|..|.| |||      |....:.|           :||
Mouse    16 SLRKHLPESLKVYGTVFHINQGNPFKLKTLVDK-WPD------FNTVVIRPQEEDMTDDLDHYNN 73

  Fly    78 IYQTLGIFCPSAHIEHVDMLRTEDVLIDWQKPMYLNFTHIAIMNRLDDF--------YSKFGVME 134
            .|...     |...:|.........:|:|::       |:.|.:...|.        .:..|.::
Mouse    74 TYLVY-----SKDPKHCQEFLGSSEVINWKQ-------HLQIQSSQSDLGKVIESLGATNLGKVK 126

  Fly   135 RLSGDIY-VC---NKLNADL-----------ELEPLPEDA-EMRLLNLDNVQGIHDL--YPANE- 180
            .....:| ||   .||...|           :|.||.:.. :...|::.:...::.|  :..|| 
Mouse   127 HKQCFLYMVCQTAKKLAPSLMDAKNLVVSRNKLTPLDQQLFKFASLDVTHAALVNSLWHFGGNEK 191

  Fly   181 ----IE-CVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRRMGYGIRLAKS 240
                || |:..|       |...|...| |...:|.:..:.|.:....|.|.:||......:|..
Mouse   192 SQKFIERCIFTF-------PSFCIMGPE-GTPVSWTLMDHTGELRMGGTLPKYRRQSLIYHVASQ 248

  Fly   241 LTQLVIERGYTPFVVIRPGNDASRSLYTKLG 271
            ..|.:.:.|:..:..:...|...:.:...||
Mouse   249 QIQTLEKLGFPMYAHVDKANFTVQRMVGLLG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 15/76 (20%)
Keg1NP_083826.1 Gly_acyl_tr_N 10..205 CDD:283638 44/214 (21%)
Gly_acyl_tr_C 206..294 CDD:117021 15/75 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.