DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and CG15155

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_609868.1 Gene:CG15155 / 35087 FlyBaseID:FBgn0032669 Length:258 Species:Drosophila melanogaster


Alignment Length:299 Identity:59/299 - (19%)
Similarity:106/299 - (35%) Gaps:89/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ELPEILVTLERYLPESLKFHQTIKTYL-----NDRIWDFKFYVAKDWPDKPIILHFPGCTLAPHN 76
            :|.::.....|..|:..|.:..:.|:|     :|::.|.:.|...:                   
  Fly    11 QLGDLKRVFTREWPKYCKEYYCLDTFLELYKKDDQLKDVQVYALPN------------------- 56

  Fly    77 NIYQTLGIFCPSAHIE-HVDMLRTE--DVLIDWQKPMYLNFTHIAIMNRLDDFY--SKFGVMER- 135
               ..||||....|.: .|..|..|  :.|.   |...|.|          ..|  .:|..|.: 
  Fly    57 ---LELGIFVIVDHYQIFVGFLEAEQSESLF---KESLLKF----------KLYGGEQFASMPKR 105

  Fly   136 ---LSGDIYVCNKLNADL-----------------ELEPLPEDAEMRLLNLDNVQGIHDLYPANE 180
               ::.||.....|..||                 ::|| |....::.:::|:.|.|:|.:..:|
  Fly   106 YFNVANDIIQAKNLKLDLDCVTLSLVLSKEEALLFQVEP-PAGFSLKPVDIDDAQVINDQWEWSE 169

  Fly   181 IECVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRRMGYGIRLAKSLTQLV 245
            .:             .|.:.|::        :.:..|.:..:|.:..::|.|:|..:.|...:..
  Fly   170 PD-------------SLSVVRRQ--------ILAPDGLLAVLQVKTTYKRRGFGQLIVKEFARQE 213

  Fly   246 IERGYTPFVVIRPGNDASRSLYTKLGYEKAFETCRVRMT 284
            ...|......:.|.|.||..|:||||: |..:.|...||
  Fly   214 ALLGRDTITEVVPENKASLGLFTKLGF-KINDQCHWLMT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 20/84 (24%)
CG15155NP_609868.1 NAT_SF <183..249 CDD:302625 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.