DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and Glyatl1

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001119750.1 Gene:Glyatl1 / 309227 RGDID:1564894 Length:296 Species:Rattus norvegicus


Alignment Length:280 Identity:64/280 - (22%)
Similarity:112/280 - (40%) Gaps:61/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HFRLVHESELPEIL-VTLERYLPESLKFHQTIKTYLNDRIWDFKFYVAKDWPDKPIILHFP---- 68
            |.|   .|::.::| .:|.:|||||||.:.|:........:..|..|.| |||...::..|    
  Rat     3 HLR---SSQMLQMLESSLRKYLPESLKVYGTVFHMNQGNPFKLKALVDK-WPDFNTVVVRPQEQD 63

  Fly    69 -GCTLAPHNNIYQTLGIFCPSAHIEHVDMLRTEDVLIDWQKPMYLNFTHIAIMNRLDDFYS-KFG 131
             ...|..|.|.||   |:..... :.:..|.|.|| |:|::.:.:..:..::...:.||.: |..
  Rat    64 MADDLDHHTNTYQ---IYSKDPK-QCLAFLGTPDV-INWKQHLQIQSSQSSLNEAITDFAAGKKV 123

  Fly   132 VMERLSGDIYVCNKLNADLELEP-LPEDAEMRLLNLDNVQG-----IHDLYPANEIE-------- 182
            .::|....:|:..:  ...:|.| |.||.|    |||...|     ..:::..:.::        
  Rat   124 KVKRTQCILYMMPE--TAKKLVPFLLEDTE----NLDRNPGRPRAIDQEMFKLSSLDVTHAALVD 182

  Fly   183 -----------------CVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRR 230
                             |:|:|       |...:...| |...:|.:....|.:....|.||:|.
  Rat   183 KFWQFGGSERSQRFIERCIQIF-------PSSCLLGPE-GTPVSWALMDQTGEIRMAGTVPDYRA 239

  Fly   231 MGYGIRLAKSLTQLVIERGY 250
            .|....:..:.|.::.:|||
  Rat   240 QGLISHIIYAQTLVMDKRGY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 13/55 (24%)
Glyatl1NP_001119750.1 Gly_acyl_tr_N 1..206 CDD:399190 50/224 (22%)
Gly_acyl_tr_C 207..295 CDD:117021 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.