DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and Glyat

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001009648.1 Gene:Glyat / 293779 RGDID:1307163 Length:296 Species:Rattus norvegicus


Alignment Length:279 Identity:60/279 - (21%)
Similarity:106/279 - (37%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TLERYLPESLKFHQTIKTYLNDRIWDFKFYVAKDWPDKPIILHFPGCTLAP-----------HNN 77
            :|::|||||||.:.||....:...::.|..|.| |||      |....:.|           :.|
  Rat    17 SLKKYLPESLKVYGTIYHVNHGNPFNLKALVDK-WPD------FNTVVVRPQEQEMKDDLDFYTN 74

  Fly    78 IYQTLGIFCPSAHIEHVDMLRTEDVLIDWQKPMYLNFTHIAIMNRLDDFYSKFGVMERLSGDI-Y 141
            .||..     |...|:.........:|:|::.:.:..:...:...:.:..|...:..:.|.:| |
  Rat    75 TYQIY-----SKDPENCQEFLGSSEVINWKQHLQIQSSQSHLNKAIQNLASIHSLQVKHSENILY 134

  Fly   142 VCN----KLNADL----ELEP---LPEDAEMRLLNLDNVQGIHD-------LYPANEIECVQLFD 188
            |.:    ||...|    .|.|   .|:.....:..|.::...|.       |:..|| ...:..:
  Rat   135 VVSETVRKLFPSLLDTKNLSPGSGKPKAINQEMFKLSSLDVTHAALVNKFWLFGGNE-RSQRFIE 198

  Fly   189 ILVRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRRMGYGIRLAKSLTQLVIERGYTPF 253
            ..::..|...:...| |..|:|.:....|.|....|.|.:|..|....:..|..|::.:||:.  
  Rat   199 RCIKNFPSSCVLGPE-GTPASWTLMDQTGEMRMGGTVPQYRAQGLVSFVIYSQDQIMKKRGFP-- 260

  Fly   254 VVIRPGNDASRSLYTKLGY 272
              :....|.|.::..|:.|
  Rat   261 --VYSHTDKSNTVMQKMSY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 18/77 (23%)
GlyatNP_001009648.1 Gly_acyl_tr_N 1..206 CDD:399190 41/201 (20%)
Gly_acyl_tr_C 207..295 CDD:117021 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.