DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and Gm4952

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001013784.2 Gene:Gm4952 / 240549 MGIID:3643569 Length:296 Species:Mus musculus


Alignment Length:284 Identity:65/284 - (22%)
Similarity:105/284 - (36%) Gaps:69/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HFRLVHESELPEIL-VTLERYLPESLKFHQTIKTYLNDRIWDFKFYVAKDWPDKPIILHFP---- 68
            |.|   .|::.::| .:|.:|||||||.:.|:........:..|..|.| |||...::..|    
Mouse     3 HLR---SSQMLQMLESSLRKYLPESLKVYGTVFHMNQGNPFKLKALVDK-WPDFNTVVVRPREQE 63

  Fly    69 -GCTLAPHNNIYQTLGIFCPSAHIEH-VDMLRTEDVLIDWQKPMYLNFTHIAIMNRLDDFYSKFG 131
             |..|..|.|.||..     |...:| ::.|.|.|| |:|::       |:.|.:...:...  .
Mouse    64 MGDDLDQHTNTYQIY-----SKDPKHCLEFLGTPDV-INWKQ-------HLQIQSSQSNLNE--A 113

  Fly   132 VMERLSGDIYVCNKLNADLELEP---------LPEDAE-------------MRLLNLDNVQGIHD 174
            :|:..:|.:....:....|.:.|         |.||.|             ..:..|..:...|.
Mouse   114 IMDLAAGKMVKVKRTQCILYMMPETAKKLVPSLLEDKEYLDHQSGRPRAIDQEMFKLSTLDVTHA 178

  Fly   175 -------LYPANEI------ECVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRP 226
                   .:..||.      .|:|:|       |...:...| |...:|.:....|.:....|.|
Mouse   179 PLVDKFWQFGGNERSQRFIGRCIQIF-------PSSCLLGPE-GTPVSWALMDQTGEIRMAGTVP 235

  Fly   227 DFRRMGYGIRLAKSLTQLVIERGY 250
            |:|..|....:..:.|..:.:|||
Mouse   236 DYRAQGLISHIIYAQTLAMDKRGY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 13/55 (24%)
Gm4952NP_001013784.2 Gly_acyl_tr_N 10..206 CDD:283638 48/218 (22%)
NAT_SF 207..295 CDD:302625 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.