DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and GLYATL2

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_659453.3 Gene:GLYATL2 / 219970 HGNCID:24178 Length:294 Species:Homo sapiens


Alignment Length:337 Identity:78/337 - (23%)
Similarity:123/337 - (36%) Gaps:106/337 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVHESELPEILV-TLERYLPESLKFHQTIKTYLNDRIWDFKFYVAKD-WPDKPIIL--------- 65
            ::|.|:..:||. :||:.:|||:|.:..|.. :.|:. .|...|..| |||..|::         
Human     3 VLHNSQKLQILYKSLEKSIPESIKVYGAIFN-IKDKN-PFNMEVLVDAWPDYQIVITRPQKQEMK 65

  Fly    66 ----HFPGCTLAPHNNIYQTLGIFCPSAHIEHVDMLRTEDVL-----IDWQKPMYLNFTHIAIMN 121
                |:        .|.|.   ||..:..       :.|:||     |.|::.:.:.    ....
Human    66 DDQDHY--------TNTYH---IFTKAPD-------KLEEVLSYSNVISWEQTLQIQ----GCQE 108

  Fly   122 RLDDFYSKFGVMERLSGDIYVCNKLNADLELEPLPE------DAEMRLLNL--DNVQG------- 171
            .||:...|....:.:..|.     :...|.:..||:      :.:|.|..:  ||.:|       
Human   109 GLDEAIRKVATSKSVQVDY-----MKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFL 168

  Fly   172 ---------IHDLYPANE-----IE-CVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGAMFS 221
                     .|..:..||     || |:|  |.|     |.|:...| |:|.:|:|......:..
Human   169 DASHAGLVNEHWAFGKNERSLKYIERCLQ--DFL-----GFGVLGPE-GQLVSWIVMEQSCELRM 225

  Fly   222 MQTRPDFRRMG----YGIRLAKSLTQLVIERGYTPFVV-IRPGNDASRSLYTKLGYEKAFETC-- 279
            ..|.|.:|..|    .|..|.|.|:|..|     ||.. :...|:.|......||    |:.|  
Human   226 GYTVPKYRHQGNMLQIGYHLEKYLSQKEI-----PFYFHVADNNEKSLQALNNLG----FKICPC 281

  Fly   280 ---RVRMTPDCY 288
               :.:.||..|
Human   282 GWHQWKCTPKKY 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 25/94 (27%)
GLYATL2NP_659453.3 Gly_acyl_tr_N 10..199 CDD:310541 46/219 (21%)
Gly_acyl_tr_C 202..290 CDD:117021 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.