DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and T10B10.4

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001024902.1 Gene:T10B10.4 / 181613 WormBaseID:WBGene00011681 Length:297 Species:Caenorhabditis elegans


Alignment Length:297 Identity:61/297 - (20%)
Similarity:102/297 - (34%) Gaps:76/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SLKFHQTIKTYLNDRIWDFKFYVAKDWPDKPI-ILHFPGCT-------LAPHNNIYQTLGIFCPS 88
            ::.|..:|.|.|.|           .:|:.|: :..:|..:       ...:..|..||.:    
 Worm    27 AIYFPFSIHTQLED-----------SFPESPVRVFVYPNISHPKMFFMFKDNEFIKPTLAL---- 76

  Fly    89 AHIEHVDMLRTE--DVLIDWQKPMY--LNFTHIAIMNRLDDFYSKFGVMERLSGDIYVCNKLNAD 149
            |.:....|.|.|  |::.:::..::  ....|:.|..  :.....:||..|||...:..|.|...
 Worm    77 AQVSGTSMNRLELIDLINEFRTRVFGAKRQPHLVIAE--EHLIKMYGVAMRLSSSDWTNNDLRLS 139

  Fly   150 L-----------ELEPLPEDAEMRLLNLDNVQGIHDLYPANEIECV-------------QLFDIL 190
            |           ...|||        |:.:.....::.|..|.|.|             |....|
 Worm   140 LFYMTESQKKLAMTTPLP--------NVPHGYYYDEIEPTEEAEIVNNTWKHAGAGDLEQTMAKL 196

  Fly   191 VRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRRMGYGIRLAKSLTQLVIERGYTPFVV 255
            :| ||...:  :..|:..|:.:....|...:.....|.||.|.|..:...|....:..|::||..
 Worm   197 LR-LPSSCV--RFNGKPVAFEMIDPAGFFNNQYVFEDHRRKGLGNAVEMDLIHKTLSIGFSPFKT 258

  Fly   256 IRPGN----DAS--RSLYTKLGYEK------AFETCR 280
            :...|    |||  ..|:|....|.      .|:|.|
 Worm   259 VAKDNKIVLDASIANKLWTMWSDEDGNAKTIVFQTWR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 22/97 (23%)
T10B10.4NP_001024902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.