DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and F43H9.4

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_505068.1 Gene:F43H9.4 / 179182 WormBaseID:WBGene00018400 Length:297 Species:Caenorhabditis elegans


Alignment Length:260 Identity:52/260 - (20%)
Similarity:95/260 - (36%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DKPIILH--------FPGCTLAPHNNIYQTLGIFCPS-AHIEHVDMLRTEDVLIDWQKPMYLNFT 115
            |:.|:.|        |    ||..:...:|.|:|..| |.....:...|:.:    :|.|..|..
 Worm    70 DRQILTHDGKFREEDF----LAVFDEFCKTNGLFAGSNAPSTVAEKCYTKAI----EKYMKKNNI 126

  Fly   116 HIAIMNRLDDFYS-------KFGVMERLSGDIYVCNKLNADLELEPLPEDAEMRLLNLDNVQGIH 173
            :..:.|:...|::       |:    |..||..:.:..:.|     :||...      |.::.:.
 Worm   127 NAEVQNKSTHFFAMNESQIFKY----RNYGDTTLPDGYSID-----IPESTN------DVMKIVG 176

  Fly   174 DLYPANEIECVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRRMGYGIRLA 238
            .....|    .:|.:..:|:.|.|.:  ::..||..::....:||:..:......|....|.:|.
 Worm   177 SSITPN----AKLVEEKLRRFPSLCV--RKGDELVGFISSETHGALAHLHVFDGHRGKNLGEKLE 235

  Fly   239 KSLTQLVIERGYTPFVVIRPGNDASRSLY-TKLGYEKAFETCRVRMTPDCYEDSTVGTISNTSYG 302
            ....::.||.|..|...|    |.:.|.: .|....|..:......||..::.:.....||  ||
 Worm   236 IGAAKMAIENGMRPCKFI----DTTNSFFLEKAKKSKLMDVVESNGTPLVFDQNVYSQASN--YG 294

  Fly   303  302
             Worm   295  294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 17/85 (20%)
F43H9.4NP_505068.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.