DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and glyatl2

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_002941419.1 Gene:glyatl2 / 100490041 XenbaseID:XB-GENE-22068497 Length:282 Species:Xenopus tropicalis


Alignment Length:278 Identity:54/278 - (19%)
Similarity:107/278 - (38%) Gaps:60/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LERYLPESLKFHQTIKTYLNDRIWDFKFYVAKDWPD------KPIILHFPGCTLAPHNNIYQTLG 83
            |..:||::||.:.::.:.|....::.:..| ..||:      :|:... |.|.  |:.|.|    
 Frog    17 LRGHLPDALKIYGSLFSILKGNPFNLEVLV-DSWPNYGAVMTRPLTAP-PICD--PYTNSY---- 73

  Fly    84 IFCPSAHIEHVDMLRTEDVL--IDWQKPMYLNFTHIAIMNRLDDFYSKFGVMERLSGDIYVCNKL 146
                |..|.  |..|...||  |:|.:...:.......||::     :....:|           
 Frog    74 ----SFFIR--DENRIHAVLEHINWNQAFEIQSMQNYFMNKI-----RHEAAQR----------- 116

  Fly   147 NADLELEPL------------PEDAEMRLLNLD-------NVQGIHDLYPANEIECVQLF-DILV 191
            |.|.|:..|            .|..:....||:       .|..:.|.:........|.: .:.:
 Frog   117 NVDTEISLLRTYYQGTQKETGGEQVQRHQKNLEFCSLSPAYVSLVDDSWTFGRCSASQEYVSLCI 181

  Fly   192 RKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRPDFRRMGYGIRLAKSLTQLVIERGYTPFVVI 256
            :..|...:.  ::|...:|::..:||||..:.|.|..||.|.|.::...|::::.::....:..:
 Frog   182 KSHPSCCVL--DSGIPVSWVLCDHYGAMRMLYTVPQERRKGLGSKVCSVLSEIMTKQNRPIYCHV 244

  Fly   257 RPGNDASRSLYTKLGYEK 274
            ...|..|:.::..||.::
 Frog   245 EEENIPSQLMFKDLGLQE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 17/79 (22%)
glyatl2XP_002941419.1 Gly_acyl_tr_N 10..186 CDD:368708 36/198 (18%)
NAT_SF 187..259 CDD:388411 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.