DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15628 and GLYATL1B

DIOPT Version :9

Sequence 1:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001342495.1 Gene:GLYATL1B / 100287520 HGNCID:37865 Length:302 Species:Homo sapiens


Alignment Length:325 Identity:63/325 - (19%)
Similarity:121/325 - (37%) Gaps:70/325 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVHESE-LPEILVTLERYLPESLK-----FHQTIKTYLNDRIWDFKFYVAKDWPDKPIILHFP-- 68
            |::.|| |..:..:|.|.:|||||     ||.......|..:      :...||:..:::..|  
Human     3 LLNNSERLLALFKSLARSIPESLKVYGSLFHINHGNPFNMEV------LVDSWPEYQMVIIRPQK 61

  Fly    69 ---GCTLAPHNNIYQTLGIFCPSAHIEHVDMLRTEDVL-----IDWQKPMYL---------NFTH 116
               ...:..:.|:|:...          .|..::::||     |:|::.:.:         ....
Human    62 QEMTDDMDSYTNVYRVFS----------KDPQKSQEVLKNSEIINWKQKLQIQGFQESLGEGIRA 116

  Fly   117 IAIMNRLDDFYSK---FGVMERLSGDIYVCNKL---------NADLELEPLPEDAEMRLLNLDNV 169
            .|..|.:...:|:   |...:.|.  :|..||.         :.|.|||....:.:...||:...
Human   117 AAFSNSVKVEHSRALLFVTEDILK--LYATNKSKLGSWAETGHPDDELESETPNFKYAQLNVSYS 179

  Fly   170 QGIHDLYPAN-EIECVQLFDILVRKLPGLGIFRKETGELAAWMV---HSYYGAMFSMQTRPDFRR 230
            ..::|.:... ....::.....:..||...:...| |...:|:.   ....|..:|::   .:||
Human   180 GLVNDNWKLGMNKRSLRYIKRCLGALPAACMLGPE-GVPVSWVTMDPSCEIGMGYSVE---KYRR 240

  Fly   231 MGYGIRLAKSLTQLVIERGYTPFV--VIRPGNDASRSLYTKLGYEKAFETCRVRMTPDCYEDSTV 293
            .|.|.||.....:.:.::. .||.  |:.......|.. :.||:.:|  :|:.... :||..:.|
Human   241 RGNGTRLIMRCMKYLCQKN-IPFYGSVLEENQGVIRKT-SALGFLEA--SCQWHQW-NCYPQNLV 300

  Fly   294  293
            Human   301  300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15628NP_001260047.1 FR47 196..281 CDD:117022 19/89 (21%)
GLYATL1BNP_001342495.1 Gly_acyl_tr_N 10..207 CDD:310541 37/214 (17%)
NAT_SF 208..296 CDD:327402 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.