DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3225 and Y108F1.5

DIOPT Version :9

Sequence 1:NP_608860.1 Gene:CG3225 / 33680 FlyBaseID:FBgn0031631 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001361911.1 Gene:Y108F1.5 / 353490 WormBaseID:WBGene00022433 Length:147 Species:Caenorhabditis elegans


Alignment Length:149 Identity:61/149 - (40%)
Similarity:92/149 - (61%) Gaps:3/149 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 LLSALESLFALDAIDEQGNLTKPVGYLLAELPFSAMLSKMLYVSGQMGCSEEIITIIALLQVQSI 503
            :::.||.|:||.||||...||.|:|..:||.|...|.||.|..|.:.||..|::||:|::|:|.:
 Worm     1 MINGLELLYALGAIDETSQLTSPLGLQMAEFPLPPMHSKCLLKSAEFGCFTEMVTIVAMMQIQDV 65

  Fly   504 FSRPASAVAQQSGRIAHRKFEVAEGDFITMLNAYTGFVEEGMTKEFCGQYFLIYRNLKRAHSLRE 568
            |..|..  .:....:..:||.|.||:.|||||.:|.|||.|.:|::|..:|:.||.|.||.::|.
 Worm    66 FITPYR--QRHQADVIRKKFAVEEGNHITMLNVFTKFVENGRSKKWCSDHFVNYRGLMRADNVRS 128

  Fly   569 QLITVARKKYGIPIFSCKG 587
            ||:.:. |::.|...|.:|
 Worm   129 QLVRLL-KRFEIEKVSSRG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3225NP_608860.1 HrpA 40..668 CDD:224557 61/149 (41%)
DEXDc 64..202 CDD:238005
HELICc 289..380 CDD:197757
HA2 448..534 CDD:214852 35/85 (41%)
OB_NTP_bind <581..670 CDD:285018 2/7 (29%)
Y108F1.5NP_001361911.1 HrpA <1..>144 CDD:224557 59/145 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156495
Domainoid 1 1.000 56 1.000 Domainoid score I7331
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.864974 Normalized mean entropy S807
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000059
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.