DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slf and CG4115

DIOPT Version :9

Sequence 1:NP_001260046.1 Gene:slf / 33678 FlyBaseID:FBgn0287234 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_650179.1 Gene:CG4115 / 41499 FlyBaseID:FBgn0038017 Length:220 Species:Drosophila melanogaster


Alignment Length:226 Identity:100/226 - (44%)
Similarity:131/226 - (57%) Gaps:12/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IATFCVVMACSHAARTTTTTATKPGRFLSLPVPAKCASRP-KEFSYRGKNMFLTTHVPALANKKV 70
            ||..||:...|..:........:|      |.|..||.|. .|.:..||..|.:...|.|...:.
  Fly     6 IAGVCVLSVLSLGSAQFQNGRLEP------PNPQLCAQRVIHEKTPDGKGYFFSWRDPQLKGVEE 64

  Fly    71 DWLDGRNLCREYCMDLVALETQEKNNLIFRVIQQNDVPYIWTAGRICDFAGCENRPDLEPKTVYG 135
            |||..||.||..|||.|:|||..:|..|.:.:.:.:|.||||:||:|||.||: ||||:|..:.|
  Fly    65 DWLTARNYCRRRCMDSVSLETSLENEWIKQYVVRENVKYIWTSGRLCDFKGCD-RPDLQPTNING 128

  Fly   136 WFWSATREKIQATNRIPQGWGYNPWSQTGHKKRPQPDNAEYDINQTKEQCLSVLNNVYNDGIAWH 200
            |||:||.:|:..|....||    .||.||....|||||.||..|...|.||::||..||||:.||
  Fly   129 WFWTATLQKLAPTTERNQG----DWSPTGGIGLPQPDNREYKQNGAPENCLALLNQFYNDGVNWH 189

  Fly   201 DVACYHEKPVICEDNEELLRYVAATNPGIRL 231
            ||||:|:|..:||:|:.||:||..|||.:|:
  Fly   190 DVACHHKKSFVCEENDALLKYVRYTNPNLRI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slfNP_001260046.1 CLECT 67..213 CDD:153057 72/145 (50%)
CG4115NP_650179.1 CLECT 65..202 CDD:153057 72/141 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102740at6656
OrthoFinder 1 1.000 - - FOG0008562
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6484
65.950

Return to query results.
Submit another query.