DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment slf and si:dkey-81n2.1

DIOPT Version :9

Sequence 1:	NP_001260046.1	Gene:	slf / 33678	FlyBaseID:	FBgn0287234	Length:	231	Species:	Drosophila melanogaster
Sequence 2:	XP_021333050.1	Gene:	si:dkey-81n2.1 / 100149443	ZFINID:	ZDB-GENE-070705-492	Length:	375	Species:	Danio rerio

Alignment Length:	178	Identity:	37/178 - (20%)
Similarity:	60/178 - (33%)	Gaps:	67/178 - (37%)

- Green bases have known domain annotations that are detailed below.

  Fly    67 NKKVDWLDGRNLCREYCMDLVALETQEKNNLIFRVI--QQNDVPYIWTAGRICDFAGCENRPDLE 129
            ::.::|.|.::.||:...|||::..|.:|..:.:.|  :.:....:| .|...|
Zfish   140 DQMMNWRDAQSYCRQNHTDLVSVRNQNENQQLEKFINDRNSSGAEVW-IGLFRD----------- 192

  Fly   130 PKTVYGWFWSATREKIQATNRIPQGWGYNPWSQTGHKKRPQPDNAEYDINQTKEQCLSVLNNVYN 194
                 .|.||      ..:|...:.|      .||     :|:|.|       |.|..:..|...
Zfish   193 -----SWQWS------DQSNSSFRYW------NTG-----EPNNVE-------ESCAVIGKNPQR 228

  Fly   195 DGIAWHDVACYHEK-PVICEDNE--------------------ELLRY 221
               .|.||.|...| |.:|.:.:                    |.|||
Zfish   229 ---GWADVLCDGRKIPFVCHEGDFCFVLCPDKLIVIQQNLSWSEALRY 273

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
slf	NP_001260046.1	CLECT	67..213	CDD:153057	32/148 (22%)
si:dkey-81n2.1	XP_021333050.1	CLECT	23..131	CDD:321932
		CLECT_1	136..245	CDD:153072	32/148 (22%)
		CLECT	260..372	CDD:153057	4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1038166at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010