Sequence 1: | NP_001260046.1 | Gene: | slf / 33678 | FlyBaseID: | FBgn0287234 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021333043.1 | Gene: | si:dkey-83f18.11 / 100003110 | ZFINID: | ZDB-GENE-070705-496 | Length: | 524 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 40/204 - (19%) |
---|---|---|---|
Similarity: | 60/204 - (29%) | Gaps: | 76/204 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 HAARTTTTTATKPGRFLSLPVPAKCAS------------RPKEFSYRGKNMFLTTHVPALANKKV 70
Fly 71 DWLDGRNLCREYCMDLVALETQEKNNLIFRVIQQNDVPYIWTAGRICDFAGCENRPDLEPKTVYG 135
Fly 136 WFWSATREKIQATNRIPQGWGYNPWSQTGHKKRPQPDNAEYDINQTKEQCLSVLNNVYNDG---I 197
Fly 198 AWHDVACYH 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slf | NP_001260046.1 | CLECT | 67..213 | CDD:153057 | 29/143 (20%) |
si:dkey-83f18.11 | XP_021333043.1 | CLECT | 25..>68 | CDD:321932 | |
CLECT | 66..>141 | CDD:321932 | |||
CLECT_1 | 185..288 | CDD:153072 | 30/163 (18%) | ||
CLECT | 291..403 | CDD:321932 | |||
CLECT | 409..521 | CDD:153057 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1038166at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |