DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slf and si:ch211-225k7.4

DIOPT Version :9

Sequence 1:NP_001260046.1 Gene:slf / 33678 FlyBaseID:FBgn0287234 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001116876.1 Gene:si:ch211-225k7.4 / 100002702 ZFINID:ZDB-GENE-060503-28 Length:367 Species:Danio rerio


Alignment Length:178 Identity:40/178 - (22%)
Similarity:68/178 - (38%) Gaps:55/178 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FLTTHVPALANKKVDWLDGRNLCREYCMDLVALETQEKNNLIFRVI--QQNDVPYIWTAGRICDF 119
            |.|:.......:.::|.|.::.||:..:|||::..|.:|..:.:.|  :::....:| .|...| 
Zfish   130 FNTSRGLVFVKQTMNWRDAQSYCRQNHIDLVSVRNQNENQQLEKFINDRKSSGSTVW-IGLFRD- 192

  Fly   120 AGCENRPDLEPKTVYGWFWSATREKIQATNRIPQGWGYNPWSQTGHKKRPQPDNAEYDINQTKEQ 184
                           .|.||   ::..::.|.   |..|           ||||     ....|.
Zfish   193 ---------------SWQWS---DQSSSSFRY---WDNN-----------QPDN-----RGGIEN 220

  Fly   185 CLSVLNNVYNDGIAWHDVACYH--------EKPVICEDN---EELLRY 221
            |..:..||...   |||::|.|        :|.::.:.|   .|.|||
Zfish   221 CTVITQNVQRQ---WHDISCEHHFCFVLCPDKLLVVQQNLLWSEALRY 265

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
slfNP_001260046.1 CLECT 67..213 CDD:153057 33/155 (21%)