DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slf and si:dkey-83f18.7

DIOPT Version :9

Sequence 1:NP_001260046.1 Gene:slf / 33678 FlyBaseID:FBgn0287234 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001093541.1 Gene:si:dkey-83f18.7 / 100001364 ZFINID:ZDB-GENE-070705-506 Length:364 Species:Danio rerio


Alignment Length:164 Identity:31/164 - (18%)
Similarity:59/164 - (35%) Gaps:50/164 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 NKKVDWLDGRNLCREYCMDLVALETQEKNNLIFRVI--QQNDVPYIWTAGRICDFAGCENRPDLE 129
            |:.::|...::.||:..:|||.:..|.::..:.:.|  :.:....:| .|...|           
Zfish   140 NQNMNWTVAQSYCRQNHIDLVTVRNQNESQQLEKFINDRNSSGSAVW-IGLFRD----------- 192

  Fly   130 PKTVYGWFWSATREKIQATNRIPQGWGYNPWSQTGHKKRPQPDN----AEYDINQTKEQCLSVLN 190
                 .|.||      ..:|...:.|..| :..:.:....||:.    |:|..|           
Zfish   193 -----TWQWS------DQSNSSFRYWAAN-FKDSSYSAAIQPNISGQWADYSSN----------- 234

  Fly   191 NVYNDGIAWHDVACYHEKPVICEDNE---ELLRY 221
              ||.    ....|:.:|.::.:..:   |.|||
Zfish   235 --YNQ----FPFVCHEDKLIVIQQTKSWSEALRY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slfNP_001260046.1 CLECT 67..213 CDD:153057 27/151 (18%)
si:dkey-83f18.7NP_001093541.1 CLECT 23..131 CDD:295302
CLECT 134..243 CDD:295302 25/143 (17%)
CLECT 249..361 CDD:153057 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.