DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3294 and AT3G44785

DIOPT Version :10

Sequence 1:NP_608857.2 Gene:CG3294 / 33677 FlyBaseID:FBgn0031628 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_974385.1 Gene:AT3G44785 / 2745945 AraportID:AT3G44785 Length:75 Species:Arabidopsis thaliana


Alignment Length:56 Identity:13/56 - (23%)
Similarity:26/56 - (46%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 HLLRVMETHPEERACEFFSRTNCCRYGHACTFNHRRPMLGRILLIRHFFNHSMLQK 211
            ||..:..|..:...|.|:.:...||.|..|:..:.:|.:...||:.:.:....|::
plant     4 HLASIYGTEKDRVNCPFYFKIGVCRNGDRCSRLYTKPSISPTLLLSNTYQQGRLKQ 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3294NP_608857.2 RRM_SF 197..303 CDD:473069 3/15 (20%)
AT3G44785NP_974385.1 zf-CCCH 13..36 CDD:459885 6/22 (27%)

Return to query results.
Submit another query.