Sequence 1: | NP_787975.1 | Gene: | fipi / 33676 | FlyBaseID: | FBgn0031627 | Length: | 450 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001352835.1 | Gene: | PAPLN / 89932 | HGNCID: | 19262 | Length: | 1278 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 54/195 - (27%) |
---|---|---|---|
Similarity: | 88/195 - (45%) | Gaps: | 27/195 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 NHHESLSLSPAEHSVVRYTNESLIVQCRS---PDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQ 81
Fly 82 LKIVFAHIALADKGNWSCEAADGSLHSKSF-DLIVYQKITFTENATVMTVKEGEKATILCEVKGE 145
Fly 146 PQPNVTWHFNGQPISAGAADDSKFRILADG-LLINKVTQNDTGEYACRAYQVNSIASDMQERTVL 209
Fly 210 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fipi | NP_787975.1 | IG_like | 33..115 | CDD:214653 | 17/85 (20%) |
I-set | 128..202 | CDD:254352 | 29/74 (39%) | ||
Ig | 133..>193 | CDD:299845 | 23/60 (38%) | ||
IG_like | 228..307 | CDD:214653 | |||
Ig | 235..305 | CDD:143165 | |||
FN3 | 312..415 | CDD:238020 | |||
PAPLN | NP_001352835.1 | TSP1 | 29..80 | CDD:214559 | |
ADAM_spacer1 | 183..298 | CDD:310520 | |||
TSP1 | 308..361 | CDD:214559 | |||
TSP1 | 369..424 | CDD:214559 | |||
TSP1 | 424..481 | CDD:214559 | |||
TSP1 | 488..539 | CDD:214559 | |||
Kunitz_BPTI | 753..805 | CDD:278443 | |||
Papilin_u7 | 814..905 | CDD:318767 | |||
Ig | 914..>978 | CDD:325142 | |||
I-set | 1049..1119 | CDD:254352 | 18/87 (21%) | ||
IG | 1139..1219 | CDD:214652 | 31/83 (37%) | ||
PLAC | 1235..1267 | CDD:312271 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |