DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and PAPLN

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:195 Identity:54/195 - (27%)
Similarity:88/195 - (45%) Gaps:27/195 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NHHESLSLSPAEHSVVRYTNESLIVQCRS---PDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQ 81
            |....:..||.:.  :|.|       ||:   |.|.:|  |:. .|:.:...:.::..:.:    
Human  1048 NQPRVVDASPGQR--IRMT-------CRAEGFPPPAIE--WQR-DGQPVSSPRHQLQPDGS---- 1096

  Fly    82 LKIVFAHIALADKGNWSCEAADGSLHSKSF-DLIVYQKITFTENATVMTVKEGEKATILCEVKGE 145
              :|.:.:|:.|.|.::|.|.:|....:.: .|.|..::|.:.....:||.||:.|.:||.|.||
Human  1097 --LVISRVAVEDGGFYTCVAFNGQDRDQRWVQLRVLGELTISGLPPTVTVPEGDTARLLCVVAGE 1159

  Fly   146 PQPNVTWHFNGQPISAGAADDSKFRILADG-LLINKVTQNDTGEYACRAYQVNSIASDMQERTVL 209
             ..|:.|..||.|:.   ||..:.....|| |||..:...|.|.|.|.|||.:...|...|..|:
Human  1160 -SVNIRWSRNGLPVQ---ADGHRVHQSPDGTLLIYNLRARDEGSYTCSAYQGSQAVSRSTEVKVV 1220

  Fly   210  209
            Human  1221  1220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 17/85 (20%)
I-set 128..202 CDD:254352 29/74 (39%)
Ig 133..>193 CDD:299845 23/60 (38%)
IG_like 228..307 CDD:214653
Ig 235..305 CDD:143165
FN3 312..415 CDD:238020
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767
Ig 914..>978 CDD:325142
I-set 1049..1119 CDD:254352 18/87 (21%)
IG 1139..1219 CDD:214652 31/83 (37%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.