DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and KIRREL3

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:313 Identity:80/313 - (25%)
Similarity:134/313 - (42%) Gaps:54/313 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLSLSP---AEHSVVRYTNESLIVQCRS-PDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKI 84
            :||:.|   .|.:||.:       .|.: .:|.|..:..:.:|:||:|..|.::  :|:.:.  .
Human   259 NLSVEPQPVLEDNVVTF-------HCSAKANPAVTQYRWAKRGQIIKEASGEVY--RTTVDY--T 312

  Fly    85 VFAHIALADKGNWSCEAAD--GSLH-SKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEP 146
            .|:...       |||..:  ||.: |::.|:....::| ||..::: |..|..|...|...|.|
Human   313 YFSEPV-------SCEVTNALGSTNLSRTVDVYFGPRMT-TEPQSLL-VDLGSDAIFSCAWTGNP 368

  Fly   147 QPNVTWHFNGQPISAGAADDSKFRILAD--GLLINKVTQNDTGEYACRAYQVNSIASDMQERTVL 209
            ...:.|...|..:           :|::  .|.:..|.|.|.|:|.|||. |..:.:.  ||.|.
Human   369 SLTIVWMKRGSGV-----------VLSNEKTLTLKSVRQEDAGKYVCRAV-VPRVGAG--EREVT 419

  Fly   210 MKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPAN-FTWYRKHNKLHS-NNRLYTIQS--- 269
            :.:...||.|.|   ..::|.......:.|...:.||.: ..|..|.|.|.| .:..||:::   
Human   420 LTVNGPPIISST---QTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETIST 481

  Fly   270 -DSYWSSLTIHVLNTSAFDN-YRCRARNDLGTIERTTRL-EQGEKPPSPANFQ 319
             :...|:|||..:..:.|.. |.|.|.|..|:.....|| |||.:..|.|..:
Human   482 EEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLE 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 19/85 (22%)
I-set 128..202 CDD:254352 19/75 (25%)
Ig 133..>193 CDD:299845 15/61 (25%)
IG_like 228..307 CDD:214653 23/86 (27%)
Ig 235..305 CDD:143165 20/76 (26%)
FN3 312..415 CDD:238020 2/8 (25%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352
Ig2_KIRREL3-like 171..252 CDD:143236
Ig_2 260..337 CDD:290606 22/94 (23%)
I-set 341..422 CDD:254352 25/96 (26%)
IGc2 355..406 CDD:197706 15/61 (25%)
Ig5_KIRREL3 424..521 CDD:143306 26/99 (26%)
IG_like 432..521 CDD:214653 22/88 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.