DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:419 Identity:85/419 - (20%)
Similarity:168/419 - (40%) Gaps:91/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLIGFILNLAALTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVEL-HWKSPKGEI 64
            ::|...:.||.:. .|||.:..:|..|:...|.:.|             :|::.: |.|..|   
  Fly    69 VKLACSVKNLGSY-KVAWMHFEQSAILTVHNHVITR-------------NPRISVTHDKHDK--- 116

  Fly    65 IREHK-GRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKS----FDLIVYQKITFTEN 124
               |: ..:||.....|            |:|.:.|:.  .::.:|:    ..::|...|.....
  Fly   117 ---HRTWFLHINNVQEE------------DRGRYMCQI--NTVTAKTQYGFVKVVVPPNIDDALT 164

  Fly   125 ATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRIL----------ADGLLIN 179
            ::.:.|:||:..|:.|:.||.|:|.:.|          ..||....::          .|.|.:.
  Fly   165 SSDIIVREGDNVTLRCKAKGSPEPTIKW----------KRDDGNKIVINKTLEVHDLETDSLELE 219

  Fly   180 KVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKP-IWSKTPFVSLKYAYINGTATLMCEALA 243
            ::::...|.|.|.|  .|.:...:.:| :.:.::..| :|.....|.:...:   ..||.|...|
  Fly   220 RISRLHMGAYLCIA--SNGVPPSVSKR-IKVSVDFSPMVWIPHQLVGIPIGF---NITLECFIEA 278

  Fly   244 EPPANFTWYRKHNKLHSNNRLYTIQS----DSYWSS--LTIHVLNTSAFDNYRCRARNDLGTIER 302
            .|.:...|.|:::::.:.:..|..::    .||.::  |||..:.:|.:.||:|.|:|..|.::.
  Fly   279 NPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDG 343

  Fly   303 TTRLEQGEKP---PSPANFQLRGFNSNTFDVVL----SAP----------RGPPDSPMGVNGFRI 350
            ..:|.....|   |.|....||...:...::.|    :.|          .||.:|.:......|
  Fly   344 NIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSI 408

  Fly   351 EYMTEM-EFKTDAGKWTNARRKDYAFEEG 378
            :|::.: |......|.|.:..|.:.:.:|
  Fly   409 KYLSNLNEIDKSKQKLTGSSPKGFDWSKG 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 13/87 (15%)
I-set 128..202 CDD:254352 19/83 (23%)
Ig 133..>193 CDD:299845 15/69 (22%)
IG_like 228..307 CDD:214653 20/84 (24%)
Ig 235..305 CDD:143165 20/75 (27%)
FN3 312..415 CDD:238020 17/85 (20%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/119 (18%)
Ig 69..139 CDD:143165 21/101 (21%)
IG_like 165..249 CDD:214653 20/96 (21%)
IGc2 172..237 CDD:197706 18/76 (24%)
IG_like 267..348 CDD:214653 20/83 (24%)
Ig 270..339 CDD:299845 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442835
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.