DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and DIP-delta

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:375 Identity:87/375 - (23%)
Similarity:147/375 - (39%) Gaps:97/375 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FILNLAALTAVAWANHHESLSLSPAEHSVVRYTNE---------SLIVQCRSPDPKVELHWKSPK 61
            |||.:..|..:|       |::.|:     |:||.         :|:......:|:    :..|.
  Fly     2 FILTVVKLLLIA-------LNIFPS-----RFTNRRIMFLIYMTNLVTHVMMDEPR----FAQPI 50

  Fly    62 GEI------------IREHKGR-----IHIEQ-------------------TSTEQLKIVFAHIA 90
            ..:            :.||.|.     |||::                   |.|:...::  |:.
  Fly    51 PNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSITYTDNTWLL--HVN 113

  Fly    91 LA---DKGNWSCEAADGSLHSKSFDLIVYQKITFTEN-------ATVMTVKEGEKATILCEVKGE 145
            .|   |:|.:.|:.....:.|:    :.|.::....|       .:.:.|:|.:...:.|...|.
  Fly   114 QAHQDDRGYYMCQVNTNPMISQ----VGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADGF 174

  Fly   146 PQPNVTW-HFNGQPISAGAADDSKFRIL---ADGLLINKVTQNDTGEYACRAYQVNSIASDMQER 206
            |.|.:.| ..:|:.|    |.:.|.::|   ||.|.:.||::|:.|.|.|.|  .|.:...:.:|
  Fly   175 PAPKIIWRREDGEEI----AVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIA--TNGVPPSVSKR 233

  Fly   207 TVLMKIEHKP-IWSKTPFVSLKYAYINGT-ATLMCEALAEPPANFTW-YRKHNKLHSNNRLYTIQ 268
             :::.:|..| ||.....|...    :|| .|:.|...|.|.|...| |.....|.|........
  Fly   234 -IILDVEFSPMIWVPNQLVGAP----SGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYT 293

  Fly   269 SDSYWS--SLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPA 316
            .:||.:  .|||..|....|.||||.::|.||..|.:.|:.:...|.:|:
  Fly   294 ENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 20/129 (16%)
I-set 128..202 CDD:254352 23/77 (30%)
Ig 133..>193 CDD:299845 19/63 (30%)
IG_like 228..307 CDD:214653 27/82 (33%)
Ig 235..305 CDD:143165 24/72 (33%)
FN3 312..415 CDD:238020 2/5 (40%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 15/97 (15%)
Ig 145..238 CDD:416386 25/99 (25%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 4/8 (50%)
Ig strand G 230..238 CDD:409353 1/8 (13%)
Ig 242..333 CDD:416386 30/94 (32%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 3/9 (33%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.