DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and igsf9bb

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_068072154.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1448 Species:Danio rerio


Alignment Length:284 Identity:70/284 - (24%)
Similarity:112/284 - (39%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DP----KVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSC-----EAADGS 105
            ||    :..||.||           .:.||:..:|            |:|.:.|     |....:
Zfish    81 DPEYAGRASLHGKS-----------SLRIERVRSE------------DQGWYECKVLMLEQQYHT 122

  Fly   106 LHSKSF-DLIVYQKITFTEN-ATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSK 168
            .|:.|: .|.|....|||:. ...:..|||...|:.|...|.|:|:|:|...|.|:.    |.:|
Zfish   123 FHNGSWVHLTVNAPPTFTDTPPQYVEAKEGGSITLSCTAFGNPKPSVSWLREGNPVQ----DSTK 183

  Fly   169 FRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQE--RTVLMKIEHKP-IWSKTPFVSLKYAY 230
            :::....|.:..:::.|.|.|.||||      |:..|  .|..:.::..| |.|....:::.   
Zfish   184 YKVSDGSLTLVSISREDRGAYTCRAY------SEQGEAVHTTRLLVQGPPFIVSPPENITVN--- 239

  Fly   231 INGTATLMCEALAEP-PANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRAR 294
            |:..|...|:|.|.| ...:||:.:.:.:...|.|....|.....||.|..:.......|.|...
Zfish   240 ISQDAFFTCQAEAYPGNLTYTWFWEEDNVFFKNDLKRRVSILIDGSLIISQVKPEDAGKYTCSPS 304

  Fly   295 NDLGTIERTTRLEQGEKPPSPANF 318
            |.||            :|||.:.:
Zfish   305 NSLG------------RPPSASAY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/74 (22%)
IgI_Twitchin_like 120..208 CDD:409541 27/90 (30%)
Ig strand A 120..123 CDD:409541 2/2 (100%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 1/6 (17%)
Ig strand C 149..154 CDD:409541 2/4 (50%)
Ig strand C' 156..159 CDD:409541 1/2 (50%)
Ig strand D 165..170 CDD:409541 2/4 (50%)
Ig strand E 173..178 CDD:409541 1/4 (25%)
Ig strand F 187..195 CDD:409541 5/7 (71%)
Ig strand G 198..208 CDD:409541 2/11 (18%)
IG_like 228..307 CDD:214653 19/79 (24%)
Ig strand B 235..239 CDD:409353 1/3 (33%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
FN3 312..415 CDD:238020 3/7 (43%)
igsf9bbXP_068072154.1 Ig 41..113 CDD:409353 12/54 (22%)
Ig strand B 41..45 CDD:409353
Ig strand C 57..61 CDD:409353
Ig strand E 94..98 CDD:409353 1/14 (7%)
Ig strand F 108..113 CDD:409353 1/4 (25%)
IG_like 144..223 CDD:214653 25/88 (28%)
Ig strand B 155..159 CDD:409353 1/3 (33%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 189..193 CDD:409353 1/3 (33%)
Ig strand F 203..208 CDD:409353 2/4 (50%)
Ig strand G 216..219 CDD:409353 0/2 (0%)
Ig 227..319 CDD:472250 25/105 (24%)
Ig strand B 244..248 CDD:409353 1/3 (33%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 284..288 CDD:409353 2/3 (67%)
Ig strand F 298..303 CDD:409353 2/4 (50%)
Ig strand G 312..315 CDD:409353 1/2 (50%)
Ig <343..403 CDD:472250
Ig strand C 353..358 CDD:409353
Ig strand E 378..382 CDD:409353
Ig strand F 392..397 CDD:409353
Ig 427..504 CDD:472250
Ig strand B 436..440 CDD:409353
Ig strand C 449..453 CDD:409353
Ig strand E 470..474 CDD:409353
Ig strand F 484..489 CDD:409353
FN3 <489..>734 CDD:442628
Ig strand G 497..500 CDD:409353
FN3 509..604 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.