DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment fipi and paplna

DIOPT Version :9

Sequence 1:	NP_787975.1	Gene:	fipi / 33676	FlyBaseID:	FBgn0031627	Length:	450	Species:	Drosophila melanogaster
Sequence 2:	XP_005169942.1	Gene:	paplna / 562930	ZFINID:	ZDB-GENE-070815-4	Length:	1187	Species:	Danio rerio

Alignment Length:	144	Identity:	41/144 - (28%)
Similarity:	61/144 - (42%)	Gaps:	13/144 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    53 VELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADG-SLHSKSFDLIVY 116
            |.:|| |..|:.:...:...|.:.|      :|...:...|.|.::|...|. ....:...|.|.
Zfish   978 VTIHW-SRAGQPLNSLRHSQHSDGT------LVIKQLTADDSGLYTCTVTDAQKFEERQVQLRVL 1035

  Fly   117 QKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADG-LLINK 180
            ..:..|:....:.|.:|..|.:.|.|.|| ..||.|..||.|:   ..|..:..:.||| |::|.
Zfish  1036 GDLRITKAPIDVDVVQGSTAQLACVVTGE-NVNVGWSRNGVPV---RPDGHRVHVSADGTLILNN 1096

  Fly   181 VTQNDTGEYACRAY 194
            |...|.|.|.|.||
Zfish  1097 VQSVDEGTYTCNAY 1110

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
fipi	NP_787975.1	IG_like	33..115	CDD:214653	13/62 (21%)
		I-set	128..202	CDD:254352	26/68 (38%)
		Ig	133..>193	CDD:299845	23/60 (38%)
		IG_like	228..307	CDD:214653
		Ig	235..305	CDD:143165
		FN3	312..415	CDD:238020
paplna	XP_005169942.1	TSP1	24..75	CDD:214559
		ADAM_spacer1	181..293	CDD:310520
		TSP1	303..356	CDD:214559
		TSP1	388..442	CDD:214559
		TSP1	449..498	CDD:214559
		TSP1	504..557	CDD:214559
		KU	720..771	CDD:238057
		Ig_3	839..906	CDD:316449
		IGc2	960..1022	CDD:197706	11/50 (22%)
		I-set	1039..1121	CDD:333254	27/76 (36%)
		PLAC	1142..1173	CDD:312271
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900