DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and KIRREL1

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:344 Identity:83/344 - (24%)
Similarity:129/344 - (37%) Gaps:73/344 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKG-----EIIREHKGRIHIE---QTSTEQ 81
            |.::|.:..:.|      :..|||.:..:      |.|     |:...|...:.:.   ||..|.
Human   185 LLINPTDLDIGR------VFTCRSMNEAI------PSGKETSIELDVHHPPTVTLSIEPQTVQEG 237

  Fly    82 LKIVFAHIALAD---------KGNWSCEAADGSLHSKSFDLI---------VYQKITFTENATVM 128
            .::||...|.|:         ||.:..|.|..|.:..:.|..         |:.|:..|..:|::
Human   238 ERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLV 302

  Fly   129 ---------------TVKEGEKATILCEVKGEPQPNVTW---HFNGQPISAGAADDSKF--RILA 173
                           |...|...|:.|...|.|...:||   ..|..|...|:..::..  ::|:
Human   303 NVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQVLS 367

  Fly   174 DG--LLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTAT 236
            :.  ||:..|||.|.|.|.|||. |..|.  :.||.|.:.:...||.|..   :::||.......
Human   368 NSNQLLLKSVTQADAGTYTCRAI-VPRIG--VAEREVPLYVNGPPIISSE---AVQYAVRGDGGK 426

  Fly   237 LMC-EALAEPPANFTWYRKHNKLHSNN-RLYTIQ----SDSYWSSLTI-HVLNTSAFDNYRCRAR 294
            :.| .....||....|..|.|.|.... ..||::    .....|:||| :|:......:|.|.|.
Human   427 VECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAW 491

  Fly   295 NDLGTIERTTRLEQGEKPP 313
            |..|......:||:.|..|
Human   492 NSFGPGTAIIQLEEREVLP 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 21/107 (20%)
I-set 128..202 CDD:254352 25/95 (26%)
Ig 133..>193 CDD:299845 20/66 (30%)
IG_like 228..307 CDD:214653 21/85 (25%)
Ig 235..305 CDD:143165 19/76 (25%)
FN3 312..415 CDD:238020 1/2 (50%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352
Ig 25..116 CDD:299845
Ig2_KIRREL3-like 138..219 CDD:143236 9/45 (20%)
I-set 223..304 CDD:254352 17/80 (21%)
Ig_2 227..305 CDD:290606 17/77 (22%)
Ig_2 311..405 CDD:290606 28/96 (29%)
IG_like 314..405 CDD:214653 28/93 (30%)
Ig5_KIRREL3 407..504 CDD:143306 24/99 (24%)
IG_like 416..504 CDD:214653 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.