DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and iglon5

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:300 Identity:71/300 - (23%)
Similarity:124/300 - (41%) Gaps:30/300 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAALTAVAW--ANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIR-----E 67
            ||.|.|:.|  .:..::........::.....||::::|:..:......|.:....:..     .
Zfish    10 LALLLALLWKGPSGAQAAEFGHLPDNITVLEGESVVLRCKIDEEVTHKAWLNRSNILFTGTDKWS 74

  Fly    68 HKGRIHIEQTSTEQLKIVFAHIALADKGNWSCE-AADGSLHSKSFDLIVYQKITFTENATVMTVK 131
            ...|:.:|..:.....|....:.:||:|.::|. .|.....:....|||.........:...:|.
Zfish    75 LDSRVSLENNNNSDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQDKSVN 139

  Fly   132 EGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADG--LLINKVTQNDTGEYACRAY 194
            |||...:.|...|.|:|.:||            .|.|:.:|.:|  |.|.::.::...::.|   
Zfish   140 EGEDVNLFCLAVGRPEPTITW------------KDFKYGLLNEGEFLEITEIKRHQAEDFEC--- 189

  Fly   195 QVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNK-L 258
            ..|:..:....|.|.:.:.:.||.:.   |....|.:..||.|.|||:|.|.|:|.|||...: :
Zfish   190 ITNNGVAPPDTRKVKVTVNYPPIITD---VKNMPAQVGKTAILRCEAMAVPTASFEWYRDDRRPV 251

  Fly   259 HSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLG 298
            .|:|.| .|:::...|.|....:....|.||.|.|.|.||
Zfish   252 ESDNTL-KIKNEKTRSLLLFTNVTEKHFGNYTCFASNRLG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 13/87 (15%)
I-set 128..202 CDD:254352 18/75 (24%)
Ig 133..>193 CDD:299845 15/61 (25%)
IG_like 228..307 CDD:214653 27/71 (38%)
Ig 235..305 CDD:143165 25/64 (39%)
FN3 312..415 CDD:238020
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 13/89 (15%)
Ig 35..123 CDD:299845 13/87 (15%)
Ig 125..>183 CDD:299845 16/69 (23%)
I-set 128..207 CDD:254352 20/93 (22%)
IG_like 217..298 CDD:214653 27/74 (36%)
ig 223..296 CDD:278476 26/68 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.