DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Ntm

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001418383.1 Gene:Ntm / 50864 RGDID:620958 Length:367 Species:Rattus norvegicus


Alignment Length:310 Identity:75/310 - (24%)
Similarity:127/310 - (40%) Gaps:52/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTAVAWANHHESLSLSPAEHSVVRYT-NESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQ 76
            :|.|||.|           .|.:.|. |:...:     ||:|.|                  :..
  Rat    63 VTRVAWLN-----------RSTILYAGNDKWCL-----DPRVVL------------------LSN 93

  Fly    77 TSTEQLKIVFAHIALADKGNWSCEA-ADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILC 140
            |.| |..|...::.:.|:|.::|.. .|....:....|||.......|.::.:::.||...::.|
  Rat    94 TQT-QYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTC 157

  Fly   141 EVKGEPQPNVTW-HFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQ 204
            ...|.|:|.||| |.:  |.:.|...:.::      |.|..:|:..:|||.|.|  .|.:|:.:.
  Rat   158 IATGRPEPTVTWRHIS--PKAVGFVSEDEY------LEIQGITREQSGEYECSA--SNDVAAPVV 212

  Fly   205 ERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQS 269
            .| |.:.:.:.|..|:.....:.   :....||.|||.|.|.|.|.|::...:|....:...:::
  Rat   213 RR-VKVTVNYPPYISEAKGTGVP---VGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKKGVKVEN 273

  Fly   270 DSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQ 319
            ..:.|.||...::...:.||.|.|.|.||....:..|.:..:|.|....|
  Rat   274 RPFLSRLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTLLQ 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/83 (19%)
IgI_Twitchin_like 120..208 CDD:409541 24/88 (27%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 0/6 (0%)
Ig strand C 149..154 CDD:409541 3/5 (60%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 0/4 (0%)
Ig strand E 173..178 CDD:409541 1/4 (25%)
Ig strand F 187..195 CDD:409541 5/7 (71%)
Ig strand G 198..208 CDD:409541 2/9 (22%)
IG_like 228..307 CDD:214653 21/78 (27%)
Ig strand B 235..239 CDD:409353 2/3 (67%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
FN3 312..415 CDD:238020 3/8 (38%)
NtmNP_001418383.1 Ig 44..132 CDD:472250 21/103 (20%)
Ig strand B 53..57 CDD:409382
Ig strand C 65..69 CDD:409382 2/3 (67%)
Ig strand E 98..102 CDD:409382 1/3 (33%)
Ig strand F 112..117 CDD:409382 1/4 (25%)
Ig strand G 125..128 CDD:409382 0/2 (0%)
Ig_3 136..205 CDD:464046 21/78 (27%)
Ig 223..307 CDD:472250 23/86 (27%)
Ig strand B 239..243 CDD:409408 2/3 (67%)
Ig strand C 252..256 CDD:409408 1/3 (33%)
Ig strand E 278..282 CDD:409408 2/3 (67%)
Ig strand F 292..297 CDD:409408 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.