DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr12

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:337 Identity:73/337 - (21%)
Similarity:110/337 - (32%) Gaps:155/337 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 ENATVM----TVKEGEKATILCEVKGEPQPNVT-----------WHFNGQPISAGA---ADDSKF 169
            |::.:|    ||:.|..|.::|:|.|..:..|.           ||.    :|:||   .:|.:|
  Fly    78 EDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHI----LSSGAQLYTNDERF 138

  Fly   170 RIL-ADG-----LLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKY 228
            .|| ..|     |.|..|.:.|.|.|.|:......|            |.|        ||:|:.
  Fly   139 AILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGI------------ISH--------FVNLQV 183

  Fly   229 ----AYING----------TATLMC--EALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLT 277
                |:|.|          |..|:|  |....||....|.:       |:||.            
  Fly   184 VVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQK-------NDRLI------------ 229

  Fly   278 IHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSP 342
                      || ..:|.|: |||.|         |.|.. |.|        :::..|:      
  Fly   230 ----------NY-VDSRRDI-TIETT---------PGPRT-QSR--------LIIREPQ------ 258

  Fly   343 MGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFSDF 407
                            .||:|.:|.:              .:|.||.::|:..:...|:|..|  
  Fly   259 ----------------VTDSGNYTCS--------------ASNTEPASIYVFVSKGDNMAAIS-- 291

  Fly   408 TKVEKYKTLSLE 419
                :.||.|.:
  Fly   292 ----RRKTSSAD 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653
I-set 128..202 CDD:254352 27/97 (28%)
Ig 133..>193 CDD:299845 23/79 (29%)
IG_like 228..307 CDD:214653 21/94 (22%)
Ig 235..305 CDD:143165 17/71 (24%)
FN3 312..415 CDD:238020 16/102 (16%)
dpr12NP_652462.3 IG 86..183 CDD:214652 31/120 (26%)
Ig_3 193..271 CDD:404760 27/162 (17%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/11 (9%)
Ig strand F 264..269 CDD:409353 1/18 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.