DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and NCAM2

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:612 Identity:128/612 - (20%)
Similarity:198/612 - (32%) Gaps:239/612 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAH 88
            ::|||..|.||    .||....|.:......:.|.:|:||.|...:..:..::....:|.|..|:
Human    49 TISLSKVELSV----GESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQKEGVRSRLTIYNAN 109

  Fly    89 IALADKGNWSCEAAD--GSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVT 151
            |  .|.|.:.|:|.|  |.....:..|.:|||:||.|..:....|:||.|.::|.|...|.|.|:
Human   110 I--EDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRVSSSPAPAVS 172

  Fly   152 WHFNGQPISAGAADDSKFRILADG----LLINK-------------------------------- 180
            |.::.:.::  ...|::|.:||:.    |.|||                                
Human   173 WLYHNEEVT--TISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPA 235

  Fly   181 ------------------------------------------------------------VTQND 185
                                                                        :..:|
Human   236 ISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSD 300

  Fly   186 TGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLK--YAYINGTATLMCEALAEPPAN 248
            .|.|.|||  .|....|  |:...:::..:|     ..:.||  ..|.||..||:|:|..||...
Human   301 GGPYVCRA--TNKAGED--EKQAFLQVFVQP-----HIIQLKNETTYENGQVTLVCDAEGEPIPE 356

  Fly   249 FTWYR----------------------KH--NKLH------------------------------ 259
            .||.|                      :|  :.||                              
Human   357 ITWKRAVDGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLD 421

  Fly   260 --------SNNRLY--------TIQSD--------SYW--SSLTIHVLNT--------------- 283
                    ||..:|        .|..|        .:|  ..|.:...||               
Human   422 IEYAPKFISNQTIYYSWEGNPINISCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILE 486

  Fly   284 ------SAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSP 342
                  :.|..|.|.|.|.:||..:...|...:.|.||...::...:..|..|..:    .|||.
Human   487 IAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFN----KPDSH 547

  Fly   343 MGVNGFRIEYMTEMEFKTDAGK-WTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFSD 406
            .||   .|.:. :::.|..|.: |...|.....    ...:|.||||:|.|.:|.|:.|..|..|
Human   548 GGV---PIHHY-QVDVKEVASEIWKIVRSHGVQ----TMVVLNNLEPNTTYEIRVAAVNGKGQGD 604

  Fly   407 FTKVEKYKTL--------SLEPRVSSG 425
            ::|:|.::||        |:..:.|||
Human   605 YSKIEIFQTLPVREPSPPSIHGQPSSG 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 21/83 (25%)
IgI_Twitchin_like 120..208 CDD:409541 30/183 (16%)
Ig strand A 120..123 CDD:409541 2/2 (100%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 2/6 (33%)
Ig strand C 149..154 CDD:409541 2/4 (50%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 1/4 (25%)
Ig strand E 173..178 CDD:409541 2/8 (25%)
Ig strand F 187..195 CDD:409541 5/7 (71%)
Ig strand G 198..208 CDD:409541 2/9 (22%)
IG_like 228..307 CDD:214653 31/179 (17%)
Ig strand B 235..239 CDD:409353 2/3 (67%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
FN3 312..415 CDD:238020 29/103 (28%)
NCAM2XP_011527877.1 IgI_1_NCAM-2 46..138 CDD:409452 25/94 (27%)
Ig strand A 46..51 CDD:409452 0/1 (0%)
Ig strand A' 54..58 CDD:409452 1/3 (33%)
Ig strand B 60..70 CDD:409452 3/9 (33%)
Ig strand C 74..80 CDD:409452 1/5 (20%)
Ig strand C' 83..85 CDD:409452 1/1 (100%)
Ig strand D 91..97 CDD:409452 0/5 (0%)
Ig strand E 99..107 CDD:409452 2/7 (29%)
Ig strand F 114..121 CDD:409452 2/6 (33%)
Ig strand G 126..137 CDD:409452 1/10 (10%)
Ig 142..218 CDD:472250 20/77 (26%)
Ig strand C 170..174 CDD:409353 1/3 (33%)
Ig strand E 193..197 CDD:409353 0/3 (0%)
IgI_1_MuSK 234..323 CDD:409562 9/92 (10%)
Ig strand A 234..237 CDD:409562 0/2 (0%)
Ig strand A' 242..247 CDD:409562 0/4 (0%)
Ig strand B 253..260 CDD:409562 0/6 (0%)
Ig strand C 266..271 CDD:409562 0/4 (0%)
Ig strand C' 273..275 CDD:409562 0/1 (0%)
Ig strand D 282..285 CDD:409562 0/2 (0%)
Ig strand E 289..295 CDD:409562 0/5 (0%)
Ig strand F 302..309 CDD:409562 5/8 (63%)
Ig strand G 315..323 CDD:409562 2/9 (22%)
IgI_NCAM-2 325..422 CDD:143278 18/101 (18%)
Ig strand A 325..330 CDD:143278 1/9 (11%)
Ig strand A' 334..338 CDD:143278 0/3 (0%)
Ig strand B 342..350 CDD:143278 3/7 (43%)
Ig strand C 356..362 CDD:143278 2/5 (40%)
Ig strand C' 365..368 CDD:143278 0/2 (0%)
Ig strand D 378..384 CDD:143278 0/5 (0%)
Ig strand E 387..393 CDD:143278 2/5 (40%)
Ig strand F 401..409 CDD:143278 0/7 (0%)
Ig strand G 412..422 CDD:143278 0/9 (0%)
Ig_3 426..504 CDD:464046 13/77 (17%)
FN3 521..613 CDD:238020 29/103 (28%)
fn3 619..703 CDD:394996 4/13 (31%)

Return to query results.
Submit another query.