DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and NCAM1

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens


Alignment Length:441 Identity:113/441 - (25%)
Similarity:184/441 - (41%) Gaps:70/441 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AEHSVVRYT---NESLIVQCRS---PDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAH 88
            |..::|..|   .:|:.:.|.:   |:|  .:.|.....:|.:|.....:|....:.||.|  ..
Human   216 ARQNIVNATANLGQSVTLVCDAEGFPEP--TMSWTKDGEQIEQEEDDEKYIFSDDSSQLTI--KK 276

  Fly    89 IALADKGNWSCEA------ADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQ 147
            :...|:..:.|.|      .|.::|.|.|   ...|||:.||.|.|.::  |:.|:.||..|:|.
Human   277 VDKNDEAEYICIAENKAGEQDATIHLKVF---AKPKITYVENQTAMELE--EQVTLTCEASGDPI 336

  Fly   148 PNVTWHFNGQPIS----AGAADDSKFRILADG------------LLINKVTQNDTGEYACRAYQV 196
            |::||..:.:.||    |......|...| ||            |.:..:...|.|||.|.|  .
Human   337 PSITWRTSTRNISSEEKASWTRPEKQETL-DGHMVVRSHARVSSLTLKSIQYTDAGEYICTA--S 398

  Fly   197 NSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKL--- 258
            |:|..|.|  ::.:::::.|   |.......|.:......:.||..|.|.|..:|:|....|   
Human   399 NTIGQDSQ--SMYLEVQYAP---KLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSS 458

  Fly   259 -HSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRG 322
             :||.::|...|.||   |.:...:.:.|.||.|.|.|.:|.......|.|.:.|.||:..|:..
Human   459 NYSNIKIYNTPSASY---LEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEP 520

  Fly   323 FNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKTDA---GKWTNARRKDYAFEEGATFLLT 384
            : |:|..|....|......|:      ::|..|.....:.   .||.:|:.   |..||.. .:.
Human   521 Y-SSTAQVQFDEPEATGGVPI------LKYKAEWRAVGEEVWHSKWYDAKE---ASMEGIV-TIV 574

  Fly   385 NLEPDTVYLVRAASRNLAGFSDFTKVEKYKTLSLE----PRVSSGVKETRN 431
            .|:|:|.|.||.|:.|..|..:.:...::||..:.    |::...:.|..|
Human   575 GLKPETTYAVRLAALNGKGLGEISAASEFKTQPVREPSAPKLEGQMGEDGN 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 20/93 (22%)
IgI_Twitchin_like 120..208 CDD:409541 32/103 (31%)
Ig strand A 120..123 CDD:409541 1/2 (50%)
Ig strand A' 127..131 CDD:409541 1/3 (33%)
Ig strand B 134..141 CDD:409541 2/6 (33%)
Ig strand C 149..154 CDD:409541 2/4 (50%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 1/4 (25%)
Ig strand E 173..178 CDD:409541 3/16 (19%)
Ig strand F 187..195 CDD:409541 5/7 (71%)
Ig strand G 198..208 CDD:409541 3/9 (33%)
IG_like 228..307 CDD:214653 23/82 (28%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
FN3 312..415 CDD:238020 26/105 (25%)
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653
Ig strand B 135..139 CDD:409353
Ig strand C 148..152 CDD:409353
Ig strand E 172..176 CDD:409353
Ig 211..307 CDD:472250 21/97 (22%)
Ig strand B 231..235 CDD:409353 0/3 (0%)
Ig strand C 244..248 CDD:409353 0/3 (0%)
Ig strand E 270..274 CDD:409353 2/3 (67%)
Ig strand F 284..289 CDD:409353 1/4 (25%)
Ig strand G 297..300 CDD:409353 1/2 (50%)
IgI_NCAM-1 306..412 CDD:143277 34/112 (30%)
Ig strand A 306..311 CDD:143277 1/4 (25%)
Ig strand A' 315..319 CDD:143277 2/3 (67%)
Ig strand B 324..332 CDD:143277 3/7 (43%)
Ig strand C 338..344 CDD:143277 2/5 (40%)
Ig strand C' 347..350 CDD:143277 1/2 (50%)
Ig strand D 368..374 CDD:143277 0/5 (0%)
Ig strand E 377..383 CDD:143277 1/5 (20%)
Ig strand F 391..399 CDD:143277 5/9 (56%)
Ig strand G 402..412 CDD:143277 2/11 (18%)
IG_like 421..499 CDD:214653 23/80 (29%)
Ig strand B 432..436 CDD:409353 0/3 (0%)
Ig strand C 445..449 CDD:409353 0/3 (0%)
Ig strand E 472..476 CDD:409353 3/6 (50%)
Ig strand F 486..491 CDD:409353 3/4 (75%)
fn3 511..598 CDD:394996 25/97 (26%)
fn3 612..693 CDD:394996 3/14 (21%)
PRK12323 <913..1108 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.