DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr15

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:381 Identity:74/381 - (19%)
Similarity:125/381 - (32%) Gaps:107/381 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GFILNLAALTAVAWANHHESLSLSPAEHSV-VRYT--NESLIVQCR-SPDPK----VELHWKSPK 61
            |.||.:...|.:|........|.:|...|: ::|.  .:....:|: |.:||    |.|....||
  Fly   229 GHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPK 293

  Fly    62 GEIIREHKGRIHIEQTSTEQLKIVFA----------------HIALADKGNWSCEAADGSLHSKS 110
            .|:|.|  ...|::..|..:|:.:.:                .|.|.::..|..|.       :.
  Fly   294 TELIGE--STRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEI-------ER 349

  Fly   111 FDLIVYQKITFTENATVMTVKEGEKATILCEVKGEP-QPNVTWHFNGQPISAGAADDSKFRILAD 174
            .||......|.|...|..|.    .:|........| .|:.|        :.|:.:.:......:
  Fly   350 IDLPAEVPTTSTTTTTTTTT----ASTTTTTTSTTPATPSTT--------ATGSTEGATSSETLN 402

  Fly   175 GL-------LINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTP-----FVSLK 227
            ||       :::.::|||..|....|..  ::|::.....:|.::|.....|.|.     ..|..
  Fly   403 GLVTITRSYILDAISQNDVSELGAAAGV--AVATETSTAQLLTEVEATSSTSGTSTGAGLLASTS 465

  Fly   228 YAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYW------------SSLTIHV 280
            .||..|.|..:..|.                 :.:...|..:.|.|            ::.|..:
  Fly   466 AAYAAGAAAGITTAA-----------------TGDSAATAATTSAWLTTMDAEAATTAATTTTTM 513

  Fly   281 LNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPR 336
            |.:|:|......|..   .|....:|:.|....||:|               ||||
  Fly   514 LPSSSFIKQITTASL---IIPAVVKLDSGNYTCSPSN---------------SAPR 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 22/105 (21%)
I-set 128..202 CDD:254352 14/81 (17%)
Ig 133..>193 CDD:299845 11/67 (16%)
IG_like 228..307 CDD:214653 14/90 (16%)
Ig 235..305 CDD:143165 11/81 (14%)
FN3 312..415 CDD:238020 7/25 (28%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 15/59 (25%)
V-set 204..290 CDD:284989 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.