DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr17

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:147 Identity:36/147 - (24%)
Similarity:63/147 - (42%) Gaps:24/147 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 EQTSTEQLKIVFAHIALADKGNWSCE-AADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATI 138
            :.|.:.|:|    ::..:|.|.:.|: |.:..|.:|....||..|.....:.: ..||.|.|..:
  Fly   470 DYTWSLQIK----YVEPSDAGWYECQMATEPKLSAKVHLQIV
KPKTELIGDQS-RFVKAGSKVAL 529

  Fly   139 LCEVKG--EPQPNVTWHFNGQPISAGA---------ADDSKFRILAD------GLLINKVTQNDT 186
            .|.|:|  :|...:.| |.||...:.:         .|.:.|..:.|      .|:|..|.:.|:
  Fly   530 HCIVRGTLDPPKYIIW-FRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDS 593

  Fly   187 GEYACRAYQVNSIASDM 203
            |.|.|:.....|::.|:
  Fly   594 GNYTCQPSNSVSVSVDL 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 9/40 (23%)
I-set 128..202 CDD:254352 23/90 (26%)
Ig 133..>193 CDD:299845 20/76 (26%)
IG_like 228..307 CDD:214653
Ig 235..305 CDD:143165
FN3 312..415 CDD:238020
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 5/24 (21%)
Ig 415..507 CDD:299845 9/40 (23%)
IG_like 521..612 CDD:214653 24/91 (26%)
IGc2 524..605 CDD:197706 20/81 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.