DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr11

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:75/211 - (35%) Gaps:33/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 MTVKEGEKATILCEVKGEPQPNVTW--HFNGQPISAGAA---DDSKFRILAD-----GLLINKVT 182
            :|.:.|..|.:.|.||.....:|:|  ..:|..::...|   .|.:|..:..     .|.|..|.
  Fly   127 VTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQ 191

  Fly   183 QNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMC--EALAEP 245
            ..|.|.|.|:......:::.:|.:.|:.:.|   |..:..    :|........|.|  ....||
  Fly   192 ARDAGSYECQVSTEPKVSARVQLQVVVPRTE---ILGEPD----RYVKAGSNVVLRCIVRGALEP 249

  Fly   246 PANFTWYRKHNKLHSNNRLYTIQSD-----------SYWSSLTIHVLNTSAFDNYRCRARND-LG 298
            |....||....:|.:::|.:..|.|           |...||.|.........||.|...|. ..
  Fly   250 PTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSA 314

  Fly   299 TIERTTRLEQGEKPPS 314
            |:  |..:..||...|
  Fly   315 TV--TLNIINGESSAS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653
I-set 128..202 CDD:254352 19/83 (23%)
Ig 133..>193 CDD:299845 18/69 (26%)
IG_like 228..307 CDD:214653 22/92 (24%)
Ig 235..305 CDD:143165 21/83 (25%)
FN3 312..415 CDD:238020 1/3 (33%)
dpr11NP_001262320.1 I-set 125..216 CDD:254352 20/88 (23%)
Ig 127..217 CDD:299845 20/89 (22%)
IG_like 227..320 CDD:214653 22/98 (22%)
IGc2 234..311 CDD:197706 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.