DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr16

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:148 Identity:35/148 - (23%)
Similarity:55/148 - (37%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVK 143
            |.|:|    ::.|.|.|.:.|:.|.....|....|.|....|.........||.|.:..:.|.|:
  Fly   305 TLQIK----YVNLEDAGWYECQLATEPKMSAKVQLFVI
TPRTELIGDRQRFVKAGSRVELHCIVR 365

  Fly   144 G--EPQPNVTWHFNGQPISA--------------------GAADDSKFRILADGLLINKVTQNDT 186
            |  |....:.|:...|.::|                    |:.:.::..|  ..|:|..|.:..:
  Fly   366 GTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTI--GSLVIPLVRKIHS 428

  Fly   187 GEYACRAYQVNSIASDMQ 204
            |.|.|.  ..||.|:.||
  Fly   429 GNYTCE--PENSAAASMQ 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 10/35 (29%)
I-set 128..202 CDD:254352 21/95 (22%)
Ig 133..>193 CDD:299845 16/81 (20%)
IG_like 228..307 CDD:214653
Ig 235..305 CDD:143165
FN3 312..415 CDD:238020
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 10/35 (29%)
Ig <298..338 CDD:299845 10/36 (28%)
IG_like 352..447 CDD:214653 23/97 (24%)
Ig 358..439 CDD:143165 16/84 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.