DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and LSAMP

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:325 Identity:81/325 - (24%)
Similarity:141/325 - (43%) Gaps:49/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ESLIVQCRSPDPKVELHWKSPKGEIIREH-----KGRIHIEQTSTEQLKIVFAHIALADKGNWSC 99
            ::.|::|...|...::.|.:..|.|...|     ..|:.:|:..:.:..:....:.:.|:|:::|
Human    47 DTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTC 111

  Fly   100 EAADGSLH---SKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTW--------H 153
            ...  :.|   :....|||......:..::.:||.||...|::|...|.|:|.:||        .
Human   112 SVQ--TQHEPKTSQVYLIV
QVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGRE 174

  Fly   154 FNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIAS-DMQERTVLMKIEHKPI 217
            |.|        ::....||.       :|:..:|:|.|:|  .|.::| |:::  |.:.:.:.|.
Human   175 FEG--------EEEYLEILG-------ITREQSGKYECKA--ANEVSSADVKQ--VKVTVNYPPT 220

  Fly   218 WSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLN 282
            .:::   ....|.....|:|.|||.|.|..:|.|||...:::|.|.| .|:|....||||:..:.
Human   221 ITES---KSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGL-EIKSTEGQSSLTVTNVT 281

  Fly   283 TSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSPMGVNG 347
            ...:.||.|.|.|.||....:..|.:...|..|...|..|      ..|....:| |.|..|:||
Human   282 EEHYGNYTCVAANKLGVTNASLVLFKRVLPTIPHPIQEIG------TTVHFKQKG-PGSVRGING 339

  Fly   348  347
            Human   340  339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 14/82 (17%)
I-set 128..202 CDD:254352 22/82 (27%)
Ig 133..>193 CDD:299845 16/67 (24%)
IG_like 228..307 CDD:214653 28/78 (36%)
Ig 235..305 CDD:143165 27/69 (39%)
FN3 312..415 CDD:238020 11/36 (31%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 14/82 (17%)
Ig 132..215 CDD:386229 24/101 (24%)
Ig_3 219..294 CDD:372822 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143410
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.