DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and CG7166

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:392 Identity:84/392 - (21%)
Similarity:166/392 - (42%) Gaps:73/392 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 HIEQTSTEQLKIVFAH------IALADKGNWSCEAAD----GSLHSKSFDLIVYQKITFTENATV 127
            |::.|..::.|||..:      :...|.|::.|:..|    ..:|  :.:::|...:....:...
  Fly    83 HLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQLGDQENRDQVH--TVEILVPPTLRALPHNGQ 145

  Fly   128 MTVKEGEKATILCEVKGEPQPNVTWH----FNGQPISAGAADDSKFRILADGLLINKVTQNDTGE 188
            :|.::|...|:.|:..|.|.|.:.|.    |:|   ....:|.|.       |::..|.::..|.
  Fly   146 VTARKGSTVTLECKASGNPVPTIFWFKKDVFSG---PTHLSDSST-------LILENVDRHHAGT 200

  Fly   189 YACRAYQ--VNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGT----ATLMCEALAEPPA 247
            |.|.|..  .:.::.|:| .|:|          ..|.::::.::::.:    ..|:|....:..:
  Fly   201 YQCSADNGVKDRVSMDIQ-LTIL----------SPPEITVEKSWVHASEGYDVELVCIVHGDVNS 254

  Fly   248 NFTWYRKHNKLHSNNR--LYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGE 310
            ...||:....|.:.:|  :|. :.|.|  ||.|.....:.|.||.|.|.|.||   ||.:..:..
  Fly   255 EMLWYQNSFLLDATDRRSMYP-RDDRY--SLIIRNFQPTDFGNYSCVADNALG---RTKKYIEVS 313

  Fly   311 KPPSPANF---QLRGFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKT--DAGKWTNARR 370
            ..|.||:|   .|.||..: :::..:....||     ::..::.|...:..:|  ..|||.....
  Fly   314 GRPGPADFISPALSGFLDH-YNLTWTIESIPP-----LDEIKLLYRRLLMNETYQHPGKWHEYHI 372

  Fly   371 KDYAFE-EGATFLLT----NLEPDTVYLVRAASRNLAGFSDFTKVEKYKT------LSLEPRVSS 424
            |..... :|:.||::    |||.:.||.....::|..|:::.:.:.::.|      |.::.....
  Fly   373 KPTPIRTDGSHFLMSYLVKNLEHNAVYEAIVQAKNKYGWNEISDIHQFYTRNHDLLLDIDMEYKM 437

  Fly   425 GV 426
            |:
  Fly   438 GI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 10/51 (20%)
I-set 128..202 CDD:254352 18/79 (23%)
Ig 133..>193 CDD:299845 16/63 (25%)
IG_like 228..307 CDD:214653 22/84 (26%)
Ig 235..305 CDD:143165 22/71 (31%)
FN3 312..415 CDD:238020 25/112 (22%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 10/51 (20%)
Ig 56..116 CDD:143165 7/32 (22%)
IG_like 144..221 CDD:214653 20/87 (23%)
IGc2 151..209 CDD:197706 17/67 (25%)
IG_like 232..313 CDD:214653 22/86 (26%)
Ig 242..311 CDD:143165 22/74 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.