DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr13

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:375 Identity:77/375 - (20%)
Similarity:121/375 - (32%) Gaps:125/375 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILNLAALTAVAWANHHESLS-----------LSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSP 60
            |..:|.:.|....:|..|.|           .:||....||:.|::||:.            :|.
  Fly    26 IFIIAYIAACGICDHTASASPGGGKTVAATMTTPASEPSVRHINQNLIMS------------QSK 78

  Fly    61 KGE-------------------------------------------IIREHK-GRIHIEQTS--- 78
            :||                                           :::.|. .||..:.|:   
  Fly    79 EGEPVPVPQPYAQSAASAGGSSITSFDSTNVIDGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGPY 143

  Fly    79 ---TEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITF-TENATVMTVKEGEKATIL 139
               ..:.:.|..|:. |:.|      .:|.:.| .|...:|    | |||:||:|.:.|..|.:.
  Fly   144 PIPVHRPEPVENHLE-ANNG------IEGGMES-LFGTPMY----FGTENSTVVTTQIGATAHVP 196

  Fly   140 CEVKGEPQPNVTW------HFNGQPISAGAADD----SKFRILADGLLINKVTQ-NDTGEYACR- 192
            |.|....:..|:|      |.....::..::|:    :..:...|..|..|..| .|.|.|.|: 
  Fly   197 CTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQV 261

  Fly   193 -AYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPAN--FTWYRK 254
             .:...||...:.......:|...||...||         ..|..|.|..:....|:  ..||  
  Fly   262 STHPPTSIFLHLSVVEARAEITGPPIRYLTP---------GSTLRLQCRVVQNTEASEYIFWY-- 315

  Fly   255 HNKLHSNNRL-YTI--------QSDSYWSSLTIHVLNTSAFDNYRCRARN 295
                |.|..: |.|        :.|...|.|||.........|:.|.|.|
  Fly   316 ----HDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 19/131 (15%)
I-set 128..202 CDD:254352 19/86 (22%)
Ig 133..>193 CDD:299845 16/72 (22%)
IG_like 228..307 CDD:214653 19/79 (24%)
Ig 235..305 CDD:143165 18/72 (25%)
FN3 312..415 CDD:238020
dpr13NP_001033956.2 V-set 180..276 CDD:284989 23/95 (24%)
IG_like 182..262 CDD:214653 19/79 (24%)
IG_like 285..362 CDD:214653 23/92 (25%)
IGc2 292..361 CDD:197706 19/83 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.