DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and ImpL2

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:56/266 - (21%)
Similarity:99/266 - (37%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EHKGRIHIEQTSTEQLKIVFAHIA--------LADKGN---WSCEAADGSLHSKSFDLIVYQKIT 120
            |.|..:|:...:.    ::|..||        |.|..|   .|.||.:....:::|:.   ..:.
  Fly     2 EAKMNLHVCALAL----LLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEA---DWLK 59

  Fly   121 FTEN-ATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPIS----------AGAADDSKFRILAD 174
            ||:. .|.:...:|....|:||:.|...|::.|.....|.|          |..|..:..|:.:.
  Fly    60 FTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSS 124

  Fly   175 GLLINKVTQNDTGEYAC--RAYQVNSIASDM----------QERTVLMKIEHKPIWSKTPFVSLK 227
            .::.:.:::..|  |.|  |.......||.:          .|:|.....:.:.|:::...:.| 
  Fly   125 HIIDHVLSEART--YTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDL- 186

  Fly   228 YAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCR 292
               :.....|.|...|.|.|..||....||.......:.:.::   ..|.|..:......||:|.
  Fly   187 ---MGSNIQLPCRVHARPRAEITWLNNENKEIVQGHRHRVLAN---GDLLISEIKWEDMGNYKCI 245

  Fly   293 ARNDLG 298
            |||.:|
  Fly   246 ARNVVG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 13/58 (22%)
I-set 128..202 CDD:254352 17/85 (20%)
Ig 133..>193 CDD:299845 15/71 (21%)
IG_like 228..307 CDD:214653 18/71 (25%)
Ig 235..305 CDD:143165 18/64 (28%)
FN3 312..415 CDD:238020
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.