DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr20

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:268 Identity:52/268 - (19%)
Similarity:92/268 - (34%) Gaps:71/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 EQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATIL 139
            ::|....|..:|...:.|:|.:.         |.:.:. ..::.:.....||.:||:.|....:.
  Fly   236 QKTDAPMLNYIFDTFSSANKHHH---------HDQRYG-PHFEDVQRIGQATNLTVQAGSSIHLN 290

  Fly   140 CEVKGEPQPNVTW-HFNGQPISAGAADDSKFRILADG---------------------LLINKVT 182
            |.:.......|:| ..|.|  ..|..:.:...:|..|                     |.|..|.
  Fly   291 CRISLLQDKTVSWVRHNTQ--DEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVK 353

  Fly   183 QNDTGEYAC-------RAYQVN------------SIASDMQER------TVLMK--IEHKPIWSK 220
            ::|...|.|       |..|:|            .:...:||:      |:.:.  :.:..:.|.
  Fly   354 KDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYEIDSTLQLSCVVRNVAMTSS 418

  Fly   221 TPFVS-----LKYAYINGTATLMCEALAEPPANFTW-YRKHNKLHSNNRLYTIQSDSYWS-SLTI 278
            ..|..     |.|....|..::..| |.|..||.|. ..|.:|..|.|  ||.....:.: ::.:
  Fly   419 VVFWKHMDNILNYDVTRGGVSVKTE-LMEDGANSTLSIAKISKTDSGN--YTCSISEFQNFTIVV 480

  Fly   279 HVLNTSAF 286
            |:||..:|
  Fly   481 HILNGESF 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 6/39 (15%)
I-set 128..202 CDD:254352 20/114 (18%)
Ig 133..>193 CDD:299845 15/88 (17%)
IG_like 228..307 CDD:214653 18/61 (30%)
Ig 235..305 CDD:143165 16/54 (30%)
FN3 312..415 CDD:238020
dpr20NP_612066.1 IG_like 278..365 CDD:214653 17/88 (19%)
Ig 279..378 CDD:299845 20/100 (20%)
Ig 400..471 CDD:299845 18/73 (25%)
IG_like 402..480 CDD:214653 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.