DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and robo1

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:407 Identity:94/407 - (23%)
Similarity:158/407 - (38%) Gaps:72/407 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAAD--GSLHSKSFD 112
            ||..::.||..:|.|.......:|.|::      :..::|...|:|.:.|||.:  |.:.::: .
  Fly   281 DPPPKVLWKKEEGNIPVSRARILHDEKS------LEISNITPTDEGTYVCEAHNNVGQISARA-S 338

  Fly   113 LIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNG-QPISAGAADDSKFRILADGL 176
            |||:....||:..:...|.......:.|...|.|.|:|.|...| ..:....:...:..:.|||.
  Fly   339 LIV
HAPPNFTKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQHVAADGT 403

  Fly   177 L-INKVTQNDTGEYACRAYQVNSIASDMQERTVLM--KIEHKPIWSKTPFVSLKYAYINGT---- 234
            | |..|.|.|.|.|.|.|:   |:......|..|.  .::.:|    .|.:.:..|  |.|    
  Fly   404 LQITDVRQEDEGYYVCSAF---SVVDSSTVRVFLQVSSLDERP----P
PIIQIGPA--NQTLPKG 459

  Fly   235 --ATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDL 297
              |||.|.|...|.....|:...:.:.:.||...||.    |||.:..|..|....|.|.|..:.
  Fly   460 SVATLPCRATGNPSPRIKWFHDGHAVQAGNRYSIIQG----SSLRVDDLQLSDSGTYTCTASGER 520

  Fly   298 G--------TIER--TTRLEQGEKPPS----PANFQLRGFNSNTFDVVLSAPRGPPDSPMGVNGF 348
            |        |:|:  :|.|.:...|.:    |...::...:..:..:..:..:..|.:...:.|:
  Fly   521 GETSWAATLTV
EKPGSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGY 585

  Fly   349 RIEYMTEMEFKTDAGKWTNARRKDYAFEEGAT-FLLTNLEPDTVYLVRAASRNLAGFSDFTKVEK 412
            .:||.:. :.:|.   |..|.::     .|.| ..::.|.|.|.|:....:.|..|.|       
  Fly   586 TVEYFSP-DLQTG---WIVAAQR-----VGDTQVTISGLTPGTSYVFLVRAENTQGIS------- 634

  Fly   413 YKTLSLEPRVSSGVKET 429
                     |.||:..|
  Fly   635 ---------VPSGLSNT 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/66 (24%)
I-set 128..202 CDD:254352 21/75 (28%)
Ig 133..>193 CDD:299845 18/61 (30%)
IG_like 228..307 CDD:214653 26/94 (28%)
Ig 235..305 CDD:143165 22/79 (28%)
FN3 312..415 CDD:238020 18/107 (17%)
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352
Ig2_Robo 159..251 CDD:143201
I-set 255..341 CDD:254352 16/66 (24%)
Ig3_Robo 272..341 CDD:143202 16/66 (24%)
IG_like 351..436 CDD:214653 23/87 (26%)
Ig 362..444 CDD:299845 23/88 (26%)
I-set 445..531 CDD:254352 24/91 (26%)
IGc2 459..521 CDD:197706 19/65 (29%)
FN3 549..637 CDD:238020 18/112 (16%)
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.