DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and CG13506

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:503 Identity:90/503 - (17%)
Similarity:169/503 - (33%) Gaps:165/503 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NLAALTAVAWANHHESLS--LSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGR 71
            |.....||.|..:...::  .:|....|....|.|::::..||:...:.:.     ||:.:.   
  Fly    95 NFQLSNAVVWYKNRIIIANGQNPISQRVQCMLNNSILLRNVSPEDSDDYYC-----EILPQR--- 151

  Fly    72 IHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKA 136
                         |..|.||......|....|..:..:|                 .|.::|:..
  Fly   152 -------------VRQHTALRVGARLSILCDDRDITDRS-----------------QTFRQGDHH 186

  Fly   137 TILCEVKGEPQPNVTWHF---NGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNS 198
            .:.|.........:.|.|   ||||.|.    |::..:    ::::.|.:.:.|:|.|       
  Fly   187 KLECRTYLPDNATIKWSFNDLNGQPSSV----DNQNGV----IILDNVDEKNAGDYQC------- 236

  Fly   199 IASDMQER----TVLMKIEHKPIWSKTPFVSLKYAYIN----GTATLMCEALAEPPANFTWYRKH 255
            :|.|....    ||.:.:::.||      ||.....:|    .||.|.|...|:|... :::.|.
  Fly   237 LADDGSRHPPHGTVHIDVQYSPI------VSTHRHNVNTEKGATAELYCNYRAKPIGR-SYFIKD 294

  Fly   256 NKLHSNNRLY----TIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSP- 315
            .|....:..|    ::.:|...::|.:..:..|....|.|:..|.:|:.|  .::.....|.:| 
  Fly   295 GKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNE--VKVHVSYNPETPQ 357

  Fly   316 ---------------------------ANFQLRG-FNSNTFDVVLSAPRGPPDSPMGVNGFRIEY 352
                                       .::||.| :..:|..|:.:......|     |.::|.:
  Fly   358 FEDMTVEGNKVTLHWLVRSHQLLSEAMLDYQLTGSYTWSTVQVLETHRHNNTD-----NIWKITH 417

  Fly   353 MTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFSDF---------- 407
            ..|:    ..|.| :||.|                          ::|..|:|.|          
  Fly   418 QLEL----SRGVW-HARVK--------------------------TKNTKGWSHFSNDHVFEIPE 451

  Fly   408 -TKVEKYKTLSLEP---------RVSSGVKETRNMCVELGVMTLMVLM 445
             ::|:|.:.:.|.|         .:|.|...:... :.:||:.|..|:
  Fly   452 DSEVDKDEEVELPPDEIVQAGIMPMSKGAASSMQR-LNVGVILLAALL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 14/81 (17%)
I-set 128..202 CDD:254352 16/76 (21%)
Ig 133..>193 CDD:299845 14/62 (23%)
IG_like 228..307 CDD:214653 18/86 (21%)
Ig 235..305 CDD:143165 16/73 (22%)
FN3 312..415 CDD:238020 22/142 (15%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 10/55 (18%)
IGc2 83..146 CDD:197706 10/55 (18%)
IG_like 176..254 CDD:214653 20/109 (18%)
Ig 176..239 CDD:299845 16/94 (17%)
I-set 258..349 CDD:254352 22/99 (22%)
Ig 275..348 CDD:143165 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.