DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and wrapper

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:429 Identity:92/429 - (21%)
Similarity:170/429 - (39%) Gaps:86/429 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQL------KIVFAHIAL 91
            :|..|.|:::.:.|....|...:.|......::...    |.|....:::      .:..|::..
  Fly    43 TVKTYENDTVQLPCTLNTPFRYVRWHRDDVALVDSR----HPELPPPDRIMLWPNGSLQVANVQS 103

  Fly    92 ADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVMTVKE--------GEKATILCEVKGEPQP 148
            :|.|::.||....|.|      :|.|.....:.|..:.::.        |....::||.:|.|||
  Fly   104 SDTGDYYCEMNSDSGH------VVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQP 162

  Fly   149 NVTWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIE 213
            .:||..||..|...:...::     ..|::...::|..|...|       :||:......:..:.
  Fly   163 VITWRLNGNVIQPQSNTGNR-----QSLILEIKSRNQAGLIEC-------VASNGVGEPAVANVY 215

  Fly   214 HKPIWSKTPFVSLK----YAYINGTATLMCEALAEPPANFTWYR--------KHNKLHSNNRLYT 266
            ...::|  |.||:.    |..:...|.|.|...|.|.|...|:.        .|:..| .:.|.|
  Fly   216 LHVLFS--PEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTH-ESELQT 277

  Fly   267 IQSDSYWSSLTIHVLNTSAFDN-----YRCRARNDL----GTIERTTRLEQGEKPPSPANFQLR- 321
            .:|..::.:...|:|...:..|     |.|||.|.:    |::|.|.|       |.|..|::. 
  Fly   278 NRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGR-------PMPCLFKINP 335

  Fly   322 GFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYM------TEMEFKTDAGKWTNARRKDYAFEEG-- 378
            |..|:|..|::    ...:|.:.:..|::::.      ...:.:|:   ||.......| ..|  
  Fly   336 GTQSSTSHVLV----WQTESLLPIMEFKLKFRQIPSNNVTRQVRTN---WTELTIPAQA-TNGLI 392

  Fly   379 --ATFLLTNLEPDTVYLVRAASRNLAGFSDFTKVEKYKT 415
              .|:.|..|:|.::|.|...:||..|:||.:|:.::.|
  Fly   393 YITTYTLHGLQPASLYEVSVLARNSFGWSDNSKIVRFAT 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 15/87 (17%)
I-set 128..202 CDD:254352 17/81 (21%)
Ig 133..>193 CDD:299845 16/59 (27%)
IG_like 228..307 CDD:214653 25/95 (26%)
Ig 235..305 CDD:143165 23/86 (27%)
FN3 312..415 CDD:238020 26/113 (23%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 16/90 (18%)
IG_like 41..118 CDD:214653 13/78 (17%)
IG_like 145..218 CDD:214653 18/84 (21%)
Ig 147..219 CDD:299845 18/83 (22%)
I-set 224..323 CDD:254352 25/99 (25%)
IGc2 236..314 CDD:197706 20/78 (26%)
FN3 339..431 CDD:238020 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.