DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Dscam1

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:472 Identity:104/472 - (22%)
Similarity:180/472 - (38%) Gaps:112/472 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSPAEHSVVRYTNESLIVQCRSPD-PKVELHWKSPKGEI------------IREHKGRIHIEQTS 78
            |.|.:.:..:.::..  |:|::.. ||.::.||...|:.            ||..:|.:|::   
  Fly   726 LEPTDKAFAQGSDAK--VECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD--- 785

  Fly    79 TEQLKIVFAHIALADKGNWSCEAAD--GSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCE 141
                     :|...::|.:.|||.:  ||..|....:.|.....|||.....|.:.||.|.:.||
  Fly   786 ---------NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCE 841

  Fly   142 VKGEPQPNVTWHFNGQPISAGAADDSKF----RILADGLL----INKVTQNDTGEYACRAYQVNS 198
            .|||....:.|:.|...:.  ..:|:::    .||:.|::    |.:..::|:..:.|.|  .|:
  Fly   842 AKGEKPIGILWNMNNMRLD--PKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVA--TNA 902

  Fly   199 IASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNR 263
            ..||  :.::.|.::..|   :.|: :||....:|.:           ...:|.:.::   .|:.
  Fly   903 FGSD--DASINMIVQEVP---EMPY-ALKVLDKSGRS-----------VQLSWAQPYD---GNSP 947

  Fly   264 L--YTIQ---SDSYWSSL------------TIHVLNTSAFDNYRCRARNDLGTIE--RTTRLEQG 309
            |  |.|:   |.:.||.:            .:..|:.:...|.|..|.|.:||.:  ....:...
  Fly   948 LDRYIIEFKRSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITA 1012

  Fly   310 EKPPS--PANFQLRGFNSNTFDVVLSAPRGPPDSPMG-VNGFRIEY----------MTEMEFKTD 361
            |:.||  |.|.::...|..|..|....|  |.....| :.|:.:.|          ...:.|.|:
  Fly  1013 EEAPSGKPQNIKVEPVNQTTMRVTWKPP--PRTEWNGEILGYYVGYKLSNTNSSYVFETINFITE 1075

  Fly   362 AGKWTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFSDFTKVEKYKTLSLEPRVSSGV 426
            .||..|..             |.||...|.|.|...:.|..|....::.||..|....|  |...
  Fly  1076 EGKEHNLE-------------LQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTP--SQPP 1125

  Fly   427 KETRNMCVELGVMTLMV 443
            .:|  .|..|...|:.|
  Fly  1126 SDT--ACTTLTSQTIRV 1140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 19/96 (20%)
I-set 128..202 CDD:254352 20/81 (25%)
Ig 133..>193 CDD:299845 17/67 (25%)
IG_like 228..307 CDD:214653 16/97 (16%)
Ig 235..305 CDD:143165 15/88 (17%)
FN3 312..415 CDD:238020 27/115 (23%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706 16/82 (20%)
I-set 819..914 CDD:254352 26/100 (26%)
Ig 833..921 CDD:299845 23/96 (24%)
FN3 918..1011 CDD:238020 20/110 (18%)
FN3 1018..1116 CDD:238020 25/112 (22%)
FN3 1124..1217 CDD:238020 5/19 (26%)
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.