DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and DIP-theta

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:318 Identity:81/318 - (25%)
Similarity:123/318 - (38%) Gaps:66/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 ADKGNWSCEAADGSLHSK--SFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHF 154
            :|||.:.|:.....:.|:  ..|::|...|.....:|.|.::||...|:.|...|.|.|.:||..
  Fly   205 SDKGWYMCQINTDPMKSQVGYLDVVV
PPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRR 269

  Fly   155 NGQ---PISAGA---ADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIE 213
            .|.   |:..||   |.:..|      |.|.||.:.:.|.|.|.|  .|.|...:.:|.:|  |.
  Fly   270 EGGELIPLPNGAEAVAYNGSF------LTIAKVNRLNMGAYLCIA--SNGIPPTVSKRVML--IV 324

  Fly   214 HKP--IWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWS-- 274
            |.|  ||.:...|.   |.:....||.|::.|.|.:...|.:....:....|......:|.:.  
  Fly   325 HFPPMIWIQNQLVG---AALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKIT 386

  Fly   275 -SLTIHVLNTSAFDNYRCRARNDLGT---------IERTTRLEQGEKPPSPANFQLRGFNSNTFD 329
             .|||:.::...|..|||.|:|.||.         |.:||.:    ...:|.      .:.||..
  Fly   387 MRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTM----TTMAPT------VSINTVP 441

  Fly   330 VVLSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLE 387
            |||                 ::|..|..:    |...|:....|.|..|.:...|.|:
  Fly   442 VVL-----------------VKYNKEQRY----GSSQNSNTNPYNFNPGNSQQNTKLQ 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 6/24 (25%)
I-set 128..202 CDD:254352 26/79 (33%)
Ig 133..>193 CDD:299845 21/65 (32%)
IG_like 228..307 CDD:214653 23/90 (26%)
Ig 235..305 CDD:143165 21/81 (26%)
FN3 312..415 CDD:238020 15/76 (20%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 6/24 (25%)
IG_like 137..230 CDD:214653 6/24 (25%)
IG_like 240..324 CDD:214653 29/93 (31%)
IGc2 247..310 CDD:197706 23/70 (33%)
Ig 327..419 CDD:299845 24/94 (26%)
IG_like 343..420 CDD:214653 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.