DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and itgb4

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 / 335269 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio


Alignment Length:323 Identity:64/323 - (19%)
Similarity:112/323 - (34%) Gaps:99/323 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ADDSKFRILADGLL---------INKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWS 219
            |.|.|..|..||.|         |..|...:.||.       :.:..|.|.:..:|.:.:     
Zfish  1034 AKDKKDYISVDGDLSYGAGETEKIVPVKLLELGEQ-------DGLLEDKQVKQFVMDLTN----- 1086

  Fly   220 KTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHS-NNRLYTI---QSDSYWSSLTIHV 280
              |..|.|......|...:.:   :|.::...::|..:..| .:.||||   ::.:..:..|:|.
Zfish  1087 --PRQSAKLGRYPRTVITIAD---KPESSVMAFKKSTQTFSTTDSLYTIPVERTGNRETPATVHW 1146

  Fly   281 LNTSAFDNYRCRARNDL--------GTIERTTRLEQGEKP----PSPANFQLRGFNSN------- 326
            ....|       :|.|:        |..|:...:.....|    |...|.:|...::|       
Zfish  1147 RTNKA-------SRFDISSPLKFAPGEAEKNILINPRTHPSPIIPEKFNLELLDPSNNAIIGKRK 1204

  Fly   327 TFDVVLSAPRGPPDSPMGVN-GF-RIEYMTEMEFKTDAGKWTNARRKDYAF-------------- 375
            |.:|:::..||.     |.| .| ::||:|:.........::.|..|..|.              
Zfish  1205 TTEVIVTDGRGD-----GKNQDFQKMEYVTQTATSPGGRLYSPANIKAVATGPKNIRLNWKPSQN 1264

  Fly   376 --------------EEGATFL--------LTNLEPDTVYLVRAASRNLAGFSDFTKVEKYKTL 416
                          |:.|.|:        ||||:|...|.:|....|..|..:::.:.:.:||
Zfish  1265 ANGYKVKYWIYGDPEDKAKFMDVKTPQAELTNLDPYCDYEMRVCGYNALGDGNYSDIIQCQTL 1327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653
I-set 128..202 CDD:254352 11/46 (24%)
Ig 133..>193 CDD:299845 11/37 (30%)
IG_like 228..307 CDD:214653 15/90 (17%)
Ig 235..305 CDD:143165 14/81 (17%)
FN3 312..415 CDD:238020 30/151 (20%)
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248
Integrin_B_tail 625..709 CDD:285239
Calx-beta 991..1064 CDD:295344 9/29 (31%)
FN3 1242..1326 CDD:238020 15/83 (18%)
FN3 1331..1420 CDD:238020
fn3 1640..1720 CDD:278470
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.