DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr3

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:281 Identity:55/281 - (19%)
Similarity:88/281 - (31%) Gaps:99/281 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 ADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTW------HFNGQPIS 160
            ||.|.....||..:.:.||.....|        :|.|.|.|......:|:|      |.    ::
  Fly   229 ADTSQSLPIFDFGMPRNITGRTGHT--------EAIIKCRVDSLHDKSVSWIRKRDLHI----LT 281

  Fly   161 AGAA---DDSKFRILAD------GLLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKP 216
            .|.|   .|.:|::...      .|.:......|:|.|.|:......::...|...:.:..:.|.
  Fly   282 VGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKA 346

  Fly   217 IWSKTPFVSLKYAYINGTATLMCEALAEPPA-----NFTWYRKHNKLHSNNRLYTIQSDSYWSSL 276
            :.|..|.:..|    .|:|.:: ..|.:.|:     ...|||..:.:                  
  Fly   347 VISGPPDLHFK----AGSAIIL-NCLVQQPSVKDIGPIYWYRGEHMI------------------ 388

  Fly   277 TIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPD- 340
                   :.||                  .:.|: |..||.   ||          ..|:|.|: 
  Fly   389 -------TPFD------------------ADDGQ-PEIPAG---RG----------EHPQGIPED 414

  Fly   341 -SPMGVNGFRIEYMTEMEFKT 360
             ||   |....|...:|||.|
  Fly   415 TSP---NDIMSEVDLQMEFAT 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 5/12 (42%)
I-set 128..202 CDD:254352 16/88 (18%)
Ig 133..>193 CDD:299845 16/74 (22%)
IG_like 228..307 CDD:214653 9/83 (11%)
Ig 235..305 CDD:143165 8/74 (11%)
FN3 312..415 CDD:238020 16/51 (31%)
dpr3NP_001014459.2 Ig 243..330 CDD:299845 19/98 (19%)
IG_like 243..329 CDD:214653 19/97 (20%)
Ig 350..464 CDD:299845 28/148 (19%)
IG_like <441..477 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.