DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and DIP-beta

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:274 Identity:62/274 - (22%)
Similarity:116/274 - (42%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IREH----KGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADG--SLHSKSFDLIVYQKITFTE 123
            |.||    ..|:.::........:....:.:.|.|.:.|:....  .:.:.:.::::...|...|
  Fly   153 IHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEE 217

  Fly   124 NATVMTVKEGEKATILCEVKGEPQPNVTW-HFNGQPISAGAADDSKFR---ILADGLLINKVTQN 184
            .:..|.|.||..|.::|..:|.|:|.:|| ..:|:.|.|......|.:   :..:.|.::|:|::
  Fly   218 TSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRS 282

  Fly   185 DTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYING----TATLMCEALAEP 245
            :.|.|.|.|  .|.:...:.:|..|....|       |.|.:....:..    ..||:|...|.|
  Fly   283 EMGAYMCIA--SNGVPPTVSKRMKLQVHFH-------PLVQVPNQLVGAPVLTDVTLICNVEASP 338

  Fly   246 PANFTWYRKHNKL----------HSNNRLYTIQSDSYWSSLTIHV--LNTSAFDNYRCRARNDLG 298
            .|...|.|::.::          ...|.:|.|:       :.:|:  |.:|.|..|:|.::|.:|
  Fly   339 KAINYWQRENGEMIIAGDRYALTEKENNMYAIE-------MILHIKRLQSSDFGGYKCISKNSIG 396

  Fly   299 TIERTTRLEQGEKP 312
            ..|.|.||.:.|:|
  Fly   397 DTEGTIRLYEMERP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 7/55 (13%)
I-set 128..202 CDD:254352 23/77 (30%)
Ig 133..>193 CDD:299845 18/63 (29%)
IG_like 228..307 CDD:214653 22/94 (23%)
Ig 235..305 CDD:143165 21/81 (26%)
FN3 312..415 CDD:238020 1/1 (100%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 7/55 (13%)
ig 102..195 CDD:278476 7/41 (17%)
IG_like 219..307 CDD:214653 25/89 (28%)
Ig 221..307 CDD:299845 25/87 (29%)
Ig 311..404 CDD:299845 23/99 (23%)
IG_like 327..405 CDD:214653 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442808
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.