Sequence 1: | NP_787975.1 | Gene: | fipi / 33676 | FlyBaseID: | FBgn0031627 | Length: | 450 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006510497.1 | Gene: | Opcml / 330908 | MGIID: | 97397 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 336 | Identity: | 84/336 - (25%) |
---|---|---|---|
Similarity: | 130/336 - (38%) | Gaps: | 69/336 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 LTAVAWANHHESLSLSPAEHSVVRYT-NESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQ 76
Fly 77 TSTEQLKIVFAHIALADKGNWSCEA-ADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILC 140
Fly 141 EVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQE 205
Fly 206 RTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSD 270
Fly 271 SYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAP 335
Fly 336 RGPPDSPMGVN 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fipi | NP_787975.1 | IG_like | 33..115 | CDD:214653 | 17/83 (20%) |
I-set | 128..202 | CDD:254352 | 23/73 (32%) | ||
Ig | 133..>193 | CDD:299845 | 17/59 (29%) | ||
IG_like | 228..307 | CDD:214653 | 21/78 (27%) | ||
Ig | 235..305 | CDD:143165 | 21/69 (30%) | ||
FN3 | 312..415 | CDD:238020 | 9/35 (26%) | ||
Opcml | XP_006510497.1 | Ig | 44..132 | CDD:416386 | 22/103 (21%) |
Ig strand A' | 44..49 | CDD:409353 | |||
Ig strand B | 51..59 | CDD:409353 | |||
CDR1 | 59..63 | CDD:409353 | 84/336 (25%) | ||
FR2 | 64..70 | CDD:409353 | 4/5 (80%) | ||
Ig strand C | 64..70 | CDD:409353 | 4/5 (80%) | ||
CDR2 | 71..83 | CDD:409353 | 3/16 (19%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/7 (0%) | ||
FR3 | 84..118 | CDD:409353 | 11/52 (21%) | ||
Ig strand D | 87..94 | CDD:409353 | 2/24 (8%) | ||
Ig strand E | 97..103 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 110..118 | CDD:409353 | 2/7 (29%) | ||
CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 123..132 | CDD:409353 | 1/8 (13%) | ||
FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 135..206 | CDD:404760 | 21/78 (27%) | ||
Ig strand A | 135..138 | CDD:409353 | 0/2 (0%) | ||
Ig strand A' | 144..148 | CDD:409353 | 1/3 (33%) | ||
Ig strand B | 151..160 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 165..170 | CDD:409353 | 3/4 (75%) | ||
Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
Ig strand F | 198..206 | CDD:409353 | 5/9 (56%) | ||
Ig_3 | 223..300 | CDD:404760 | 21/79 (27%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 3/5 (60%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 279..283 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 293..298 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 306..309 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833600 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |